[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58742.1
DDBJ      :             Protein of unknown function DUF190
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->105 2dclC PDBj 1e-20 49.4 %
:RPS:PDB   6->105 2dclC PDBj 4e-28 47.3 %
:RPS:SCOP  9->105 1o51A  d.58.5.4 * 1e-24 48.8 %
:HMM:SCOP  5->106 1o51A_ d.58.5.4 * 1.7e-36 55.9 %
:RPS:PFM   8->104 PF02641 * DUF190 4e-28 55.7 %
:HMM:PFM   7->105 PF02641 * DUF190 5.2e-35 46.5 99/101  
:BLT:SWISS 10->107 Y7045_STRCO 2e-25 52.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58742.1 GT:GENE ABA58742.1 GT:PRODUCT Protein of unknown function DUF190 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2637511..2637852) GB:FROM 2637511 GB:TO 2637852 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF190 GB:PROTEIN_ID ABA58742.1 GB:DB_XREF GI:76884061 InterPro:IPR003793 LENGTH 113 SQ:AASEQ MKQRSEAELLRVFIGESDKYHGRPLYEVVVEEARRYGLAGATVLRGTLGFGANSRIHTAKILRLSEDLPMVVEIVDQPERIAAFLPELDALIEEGLVTLERVQVIAYRHSHTE GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 10->107|Y7045_STRCO|2e-25|52.0|98/114| BL:PDB:NREP 1 BL:PDB:REP 10->105|2dclC|1e-20|49.4|87/97| RP:PDB:NREP 1 RP:PDB:REP 6->105|2dclC|4e-28|47.3|91/97| RP:PFM:NREP 1 RP:PFM:REP 8->104|PF02641|4e-28|55.7|97/101|DUF190| HM:PFM:NREP 1 HM:PFM:REP 7->105|PF02641|5.2e-35|46.5|99/101|DUF190| RP:SCP:NREP 1 RP:SCP:REP 9->105|1o51A|1e-24|48.8|84/89|d.58.5.4| HM:SCP:REP 5->106|1o51A_|1.7e-36|55.9|102/0|d.58.5.4|1/1|GlnB-like| OP:NHOMO 141 OP:NHOMOORG 124 OP:PATTERN -----------------------------------111111111---1-122--1111111------- -12-1----------11-------1-------1---------1-------------------1---1-1-------------111111-----------------1-------------------11-1111111122222----1--------1-----------------------------2-11--------------------------------------------------------------------------------------------------------------------------------------------------------11-11---------1---------11----------3111-------1------1-211111111111-----------------------------------1-------------2------1---------------------------------1-----1-------------------------------------------------------------------11---11-11111-1111111411-11---------------------------1111---------------------------------1---------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1--------------------------------------------1-111-111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 84.1 SQ:SECSTR ###cccEEEEEEEEETTcEETTEEHHHHHHHHHHHHTccccEEEEccccccc#########cccTTccEEEEEEEEEHHHHHHHHHHHGGGccccEEEEEEEccccc###### DISOP:02AL 1-4, 109-113| PSIPRED ccccccEEEEEEEEcccccccccHHHHHHHHHHHHccccEEEEEEEEEcccccccccccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccc //