Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58755.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:HMM:PFM   17->29 PF09163 * Form-deh_trans 0.0003 30.8 13/44  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58755.1 GT:GENE ABA58755.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2649827..2650081) GB:FROM 2649827 GB:TO 2650081 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58755.1 GB:DB_XREF GI:76884074 LENGTH 84 SQ:AASEQ MITTGPWYQGTSCRHQVSVAAAAIFHWMKAPLRKGFWAIDWLSPDKGWILALHLSKLLATATVSFIEEGISSDTTIDQLILAYY GT:EXON 1|1-84:0| HM:PFM:NREP 1 HM:PFM:REP 17->29|PF09163|0.0003|30.8|13/44|Form-deh_trans| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcc //