[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58760.1
DDBJ      :             SSU ribosomal protein S11P
Swiss-Prot:RS11_NITOC   RecName: Full=30S ribosomal protein S11;

Homologs  Archaea  37/68 : Bacteria  906/915 : Eukaryota  107/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->127 1vs5K PDBj 2e-44 70.5 %
:RPS:PDB   17->124 2e5lK PDBj 3e-33 49.1 %
:RPS:SCOP  17->126 1fjgK  c.55.4.1 * 7e-35 49.1 %
:HMM:SCOP  11->127 1fjgK_ c.55.4.1 * 3.1e-43 61.5 %
:RPS:PFM   18->126 PF00411 * Ribosomal_S11 4e-30 57.8 %
:HMM:PFM   17->126 PF00411 * Ribosomal_S11 2.5e-49 54.5 110/110  
:BLT:SWISS 16->127 RS11_NITOC 4e-54 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58760.1 GT:GENE ABA58760.1 GT:PRODUCT SSU ribosomal protein S11P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2653607..2653990) GB:FROM 2653607 GB:TO 2653990 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S11P GB:PROTEIN_ID ABA58760.1 GB:DB_XREF GI:76884079 InterPro:IPR001971 LENGTH 127 SQ:AASEQ MAKTSTKKRVKRVVSDGIAHIHASFNNTIVTITDRQGNTLAWATSGGSGFRGSRKSTPFAAQVAAEKAGRIVQEMGMKNLEVRVKGPGPGRESAARSLNNVGFKVTNIADITPIPHNGCRPPKKRRV GT:EXON 1|1-127:0| SW:ID RS11_NITOC SW:DE RecName: Full=30S ribosomal protein S11; SW:GN Name=rpsK; OrderedLocusNames=Noc_2302; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 16->127|RS11_NITOC|4e-54|100.0|112/127| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 3->15|ktstkkrvkrvvs| SEG 45->56|sggsgfrgsrks| BL:PDB:NREP 1 BL:PDB:REP 16->127|1vs5K|2e-44|70.5|112/117| RP:PDB:NREP 1 RP:PDB:REP 17->124|2e5lK|3e-33|49.1|108/115| RP:PFM:NREP 1 RP:PFM:REP 18->126|PF00411|4e-30|57.8|109/109|Ribosomal_S11| HM:PFM:NREP 1 HM:PFM:REP 17->126|PF00411|2.5e-49|54.5|110/110|Ribosomal_S11| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00411|IPR001971| GO:PFM GO:0005622|"GO:intracellular"|PF00411|IPR001971| GO:PFM GO:0005840|"GO:ribosome"|PF00411|IPR001971| GO:PFM GO:0006412|"GO:translation"|PF00411|IPR001971| RP:SCP:NREP 1 RP:SCP:REP 17->126|1fjgK|7e-35|49.1|110/119|c.55.4.1| HM:SCP:REP 11->127|1fjgK_|3.1e-43|61.5|117/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 1166 OP:NHOMOORG 1050 OP:PATTERN --------11111111--------1-11111111-11-11111111-1-1111--------11111-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111--1--111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 1--11111511-111-----------------------------------------------1--------------------------121-111-------131111123322312-1121154-5-585-226121122141-11112112132221113111-133-222331319111132578-431111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 88.2 SQ:SECSTR ###############cEEEEEEccccccEEEEEcTTccEEEEEccTTTTcccGGGGcHHHHHHHHHHHHHTTGGGTccEEEEEEEcccccHHHHHHHHHHHTcEEEEEEEccccccccccccccccc DISOP:02AL 1-11, 123-127| PSIPRED cccccccccEEEEEEccEEEEEEEcccEEEEEEcccccEEEEEEcccccEEcccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHcccEEEEEEEccccccccccccccccc //