[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58764.1
DDBJ      :             LSU ribosomal protein L15P
Swiss-Prot:RL15_NITOC   RecName: Full=50S ribosomal protein L15;

Homologs  Archaea  0/68 : Bacteria  697/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->118 2zjrI PDBj 4e-19 44.1 %
:RPS:PDB   1->128 3bboN PDBj 3e-24 38.3 %
:RPS:SCOP  1->128 1vs6L1  c.12.1.1 * 1e-37 57.8 %
:HMM:SCOP  4->143 2gyaJ1 c.12.1.1 * 1.7e-45 49.3 %
:RPS:PFM   26->128 PF00828 * Ribosomal_L18e 2e-13 50.5 %
:HMM:PFM   28->142 PF00828 * Ribosomal_L18e 5.8e-25 40.2 112/129  
:BLT:SWISS 1->128 RL15_NITOC 7e-71 100.0 %
:PROS 109->139|PS00475|RIBOSOMAL_L15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58764.1 GT:GENE ABA58764.1 GT:PRODUCT LSU ribosomal protein L15P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2655984..2656418) GB:FROM 2655984 GB:TO 2656418 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L15P GB:PROTEIN_ID ABA58764.1 GB:DB_XREF GI:76884083 InterPro:IPR001196 InterPro:IPR005749 LENGTH 144 SQ:AASEQ MRLNTISSAPGAKQAEKRVGRGIGSGWGKTCGRGHKGQKSRSGGFHKVGFEGGQMPLQRRVPKFGFSSRKARFRVEVRLDQLTKVNTDTVDIAALVKARLIPKWAKRVKVIASGKLDKPVSLQGIMVSAGARRAIEAAGGRIGE GT:EXON 1|1-144:0| SW:ID RL15_NITOC SW:DE RecName: Full=50S ribosomal protein L15; SW:GN Name=rplO; OrderedLocusNames=Noc_2306; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->128|RL15_NITOC|7e-71|100.0|128/144| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 109->139|PS00475|RIBOSOMAL_L15|PDOC00386| SEG 129->143|agarraieaaggrig| BL:PDB:NREP 1 BL:PDB:REP 6->118|2zjrI|4e-19|44.1|111/141| RP:PDB:NREP 1 RP:PDB:REP 1->128|3bboN|3e-24|38.3|128/176| RP:PFM:NREP 1 RP:PFM:REP 26->128|PF00828|2e-13|50.5|101/129|Ribosomal_L18e| HM:PFM:NREP 1 HM:PFM:REP 28->142|PF00828|5.8e-25|40.2|112/129|Ribosomal_L18e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00828|IPR000039| GO:PFM GO:0005622|"GO:intracellular"|PF00828|IPR000039| GO:PFM GO:0005840|"GO:ribosome"|PF00828|IPR000039| GO:PFM GO:0006412|"GO:translation"|PF00828|IPR000039| RP:SCP:NREP 1 RP:SCP:REP 1->128|1vs6L1|1e-37|57.8|128/144|c.12.1.1| HM:SCP:REP 4->143|2gyaJ1|1.7e-45|49.3|140/0|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 747 OP:NHOMOORG 734 OP:PATTERN -------------------------------------------------------------------- -11--------------------------------------11111--------------11---------111111111--11111111111111---111111111-1111111111111111----------------111----1-111-1-----1111--1111111111111-111111111111111111111111111111111111111111111111111-11111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111-1-1111-1111111111-111111--1111-1111111111-111111---1-11----------------------1111111-1-1-1----1-1---1111---1-11111---11111111---1---11--11111------11-----1--111111-1-1-11111111111111111111111111111111111111111111111111111111111-11111111111111111-1-1-11111111111111111--11-11--------11111111111111111111111111111111111111111111111-1111111-1111-111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111-1-----1---1--11----111--111--1-1111111-1 -----11---------------------------------------------------1------111----11-------------1--------1111---111-12---2---------------------------------------------1--------------1-111---11115--2--12112-12 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 88.9 SQ:SECSTR ccccccccccccccccccccccccccccccccccccccGGGTcccccTTcccccccTTcccccccccccccccccccccccccTTTTTTTcccccccccccccccccccccccccccccccccccccT################ DISOP:02AL 8-49, 143-144| PSIPRED ccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEEccccccccccccEEEEEEHHHHHccccccccHHHHHHcccccccccEEEEEEcccccccEEEEEEEccHHHHHHHHHcccEEcc //