[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58768.1
DDBJ      :             SSU ribosomal protein S8P
Swiss-Prot:RS8_NITOC    RecName: Full=30S ribosomal protein S8;

Homologs  Archaea  12/68 : Bacteria  910/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.140.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->130 1vs5H PDBj 9e-48 66.7 %
:RPS:PDB   3->129 3bbnH PDBj 7e-42 42.5 %
:RPS:SCOP  2->129 1i6uA  d.140.1.1 * 4e-39 29.6 %
:HMM:SCOP  2->129 1seiA_ d.140.1.1 * 4.2e-43 50.8 %
:RPS:PFM   5->130 PF00410 * Ribosomal_S8 3e-32 57.9 %
:HMM:PFM   5->129 PF00410 * Ribosomal_S8 1.7e-48 56.0 125/129  
:BLT:SWISS 1->130 RS8_NITOC 8e-71 100.0 %
:PROS 100->117|PS00053|RIBOSOMAL_S8

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58768.1 GT:GENE ABA58768.1 GT:PRODUCT SSU ribosomal protein S8P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2658066..2658458) GB:FROM 2658066 GB:TO 2658458 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S8P GB:PROTEIN_ID ABA58768.1 GB:DB_XREF GI:76884087 InterPro:IPR000630 LENGTH 130 SQ:AASEQ MSMTDPISDMLTRVRNGQNAGKVEVSMPSSKLKVSIARVLKEEGYIEDCKVIADAKPTLVIRLKYYGGKPVIEDIHRASRPGLRMYKSRDKLPRIRGGLGIAIVSTSRGVMTDKTARSIGEGGEVLCYVA GT:EXON 1|1-130:0| SW:ID RS8_NITOC SW:DE RecName: Full=30S ribosomal protein S8; SW:GN Name=rpsH; OrderedLocusNames=Noc_2310; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|RS8_NITOC|8e-71|100.0|130/130| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 100->117|PS00053|RIBOSOMAL_S8|PDOC00052| BL:PDB:NREP 1 BL:PDB:REP 2->130|1vs5H|9e-48|66.7|129/129| RP:PDB:NREP 1 RP:PDB:REP 3->129|3bbnH|7e-42|42.5|127/134| RP:PFM:NREP 1 RP:PFM:REP 5->130|PF00410|3e-32|57.9|126/127|Ribosomal_S8| HM:PFM:NREP 1 HM:PFM:REP 5->129|PF00410|1.7e-48|56.0|125/129|Ribosomal_S8| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00410|IPR000630| GO:PFM GO:0005622|"GO:intracellular"|PF00410|IPR000630| GO:PFM GO:0005840|"GO:ribosome"|PF00410|IPR000630| GO:PFM GO:0006412|"GO:translation"|PF00410|IPR000630| RP:SCP:NREP 1 RP:SCP:REP 2->129|1i6uA|4e-39|29.6|125/129|d.140.1.1| HM:SCP:REP 2->129|1seiA_|4.2e-43|50.8|128/130|d.140.1.1|1/1|Ribosomal protein S8| OP:NHOMO 933 OP:NHOMOORG 930 OP:PATTERN ----------------1----------------11-------1-----------1111111---1--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 --------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1-1------1-112--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 99.2 SQ:SECSTR #ccccHHHHHHHHHHHHHHTTccEEEEEccHHHHHHTHHHHTTTccccEEEEEcccEEEEEEccccccccccccEEEcccTTcccEEcccccccGGGTTcEEEEEEcccEEcTTHHHHHTccEEEEEEEc DISOP:02AL 130-131| PSIPRED cccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccEEEEEccccEEEEEEEEEcccccccccEEcccccEEEEEcHHHHHHHHcccEEEEEEcccccccHHHHHHcccccEEEEEEc //