[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58773.1
DDBJ      :             SSU ribosomal protein S17P
Swiss-Prot:RS17_NITOC   RecName: Full=30S ribosomal protein S17;

Homologs  Archaea  6/68 : Bacteria  880/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->85 1vs7Q PDBj 7e-25 61.8 %
:RPS:PDB   10->86 3d5aQ PDBj 2e-22 44.2 %
:RPS:SCOP  10->85 1vs5Q1  b.40.4.5 * 4e-26 61.8 %
:HMM:SCOP  7->85 1fjgQ_ b.40.4.5 * 8.3e-29 59.5 %
:RPS:PFM   13->81 PF00366 * Ribosomal_S17 6e-17 65.2 %
:HMM:PFM   13->80 PF00366 * Ribosomal_S17 3.8e-31 57.4 68/69  
:BLT:SWISS 1->86 RS17_NITOC 6e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58773.1 GT:GENE ABA58773.1 GT:PRODUCT SSU ribosomal protein S17P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2660178..2660438) GB:FROM 2660178 GB:TO 2660438 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S17P GB:PROTEIN_ID ABA58773.1 GB:DB_XREF GI:76884092 InterPro:IPR000266 LENGTH 86 SQ:AASEQ MSDQEKISHTVIGRVVSDKMDKTITVLIERKVAHSLYKKYVRRFTKLHAHDENNECRMGDIVAIAGTRPLSKTKAWKLVDILERAR GT:EXON 1|1-86:0| SW:ID RS17_NITOC SW:DE RecName: Full=30S ribosomal protein S17; SW:GN Name=rpsQ; OrderedLocusNames=Noc_2315; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->86|RS17_NITOC|6e-46|100.0|86/86| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 10->85|1vs7Q|7e-25|61.8|76/81| RP:PDB:NREP 1 RP:PDB:REP 10->86|3d5aQ|2e-22|44.2|77/99| RP:PFM:NREP 1 RP:PFM:REP 13->81|PF00366|6e-17|65.2|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 13->80|PF00366|3.8e-31|57.4|68/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 10->85|1vs5Q1|4e-26|61.8|76/80|b.40.4.5| HM:SCP:REP 7->85|1fjgQ_|8.3e-29|59.5|79/104|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 933 OP:NHOMOORG 907 OP:PATTERN -----------------------------------------------1111-------11-------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111112-1--111111111111111111111111-11111111111112-1111111111-11111111111111111111111111111---11111--111111111111111-1--11-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1-11111111-111111-1111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-111111----1111111111111111111111 ---------------------------------------------------------------------------------------------------1-----1----------------------------------------------------------------------1-1G112223112-21-11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 89.5 SQ:SECSTR #########EEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEccc DISOP:02AL 1-6| PSIPRED cccccccEEEEEEEEEEcccccEEEEEEEEEEEccEEEEEEEEEccEEEEcccccEEcccEEEEEEccccccEEEEEEEEEEEccc //