[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58777.1
DDBJ      :             LSU ribosomal protein L22P
Swiss-Prot:RL22_NITOC   RecName: Full=50S ribosomal protein L22;

Homologs  Archaea  0/68 : Bacteria  808/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.55.1
:110 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->109 1vs6S PDBj 1e-22 48.6 %
:RPS:PDB   1->109 3d5bW PDBj 2e-27 37.6 %
:RPS:SCOP  5->109 1bxeA  d.55.1.1 * 2e-31 38.1 %
:HMM:SCOP  1->110 1bxeA_ d.55.1.1 * 6.5e-38 54.5 %
:RPS:PFM   8->109 PF00237 * Ribosomal_L22 1e-19 50.0 %
:HMM:PFM   5->109 PF00237 * Ribosomal_L22 3.1e-41 54.3 105/105  
:BLT:SWISS 1->110 RL22_NITOC 4e-49 100.0 %
:PROS 83->107|PS00464|RIBOSOMAL_L22
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58777.1 GT:GENE ABA58777.1 GT:PRODUCT LSU ribosomal protein L22P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2661753..2662085) GB:FROM 2661753 GB:TO 2662085 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L22P GB:PROTEIN_ID ABA58777.1 GB:DB_XREF GI:76884096 InterPro:IPR001063 InterPro:IPR005727 LENGTH 110 SQ:AASEQ MATTAILKNARLSAQKGRLVADQVRGLPVDKALDILGFSPKKASALIRKVLESAIANAEHNDGADIDELRVAAIMVNEGPTIKRIRARARGRASRVFKRSCHIKVMVSED GT:EXON 1|1-110:0| SW:ID RL22_NITOC SW:DE RecName: Full=50S ribosomal protein L22; SW:GN Name=rplV; OrderedLocusNames=Noc_2319; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->110|RL22_NITOC|4e-49|100.0|110/110| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 83->107|PS00464|RIBOSOMAL_L22|PDOC00387| SEG 84->95|rirarargrasr| BL:PDB:NREP 1 BL:PDB:REP 1->109|1vs6S|1e-22|48.6|109/110| RP:PDB:NREP 1 RP:PDB:REP 1->109|3d5bW|2e-27|37.6|109/112| RP:PFM:NREP 1 RP:PFM:REP 8->109|PF00237|1e-19|50.0|102/105|Ribosomal_L22| HM:PFM:NREP 1 HM:PFM:REP 5->109|PF00237|3.1e-41|54.3|105/105|Ribosomal_L22| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00237|IPR001063| GO:PFM GO:0005622|"GO:intracellular"|PF00237|IPR001063| GO:PFM GO:0005840|"GO:ribosome"|PF00237|IPR001063| GO:PFM GO:0006412|"GO:translation"|PF00237|IPR001063| RP:SCP:NREP 1 RP:SCP:REP 5->109|1bxeA|2e-31|38.1|105/110|d.55.1.1| HM:SCP:REP 1->110|1bxeA_|6.5e-38|54.5|110/110|d.55.1.1|1/1|Ribosomal protein L22| OP:NHOMO 815 OP:NHOMOORG 813 OP:PATTERN -------------------------------------------------------------------- 1-1-1-------1-111----1--11-----11111-1--111-11111111111111111111111111111--111-1111--111111111-----1-11111-1-1111111111111111-1-1-1--111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111-1111111112111111-111111111-11111111111---------111-11111111111111111111111111111111111111111-1----------111-11111111111-----11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111--1-------11---------11-111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111211111111111-11-1-1-11111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1--1----1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 99.1 SQ:SECSTR cccEEEEEEEEccHHHHHHHHHHTTTccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccGGGEEEEEEEEEEEEEEEcccEETTTEEcccEEEEEEEEEEEEE# PSIPRED ccEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHcEEEEEEEccccEEccEEcccccccccEEcccccEEEEEEEc //