[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58782.1
DDBJ      :             LSU ribosomal protein L3P
Swiss-Prot:RL3_NITOC    RecName: Full=50S ribosomal protein L3;

Homologs  Archaea  4/68 : Bacteria  907/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->211 1vs6D PDBj 8e-73 63.3 %
:RPS:PDB   57->211 3bboF PDBj 3e-12 42.5 %
:RPS:SCOP  3->211 1vs6D1  b.43.3.2 * 2e-72 62.8 %
:HMM:SCOP  1->215 1ffkB_ b.43.3.2 * 8.8e-80 55.1 %
:RPS:PFM   9->198 PF00297 * Ribosomal_L3 2e-45 56.1 %
:HMM:PFM   9->207 PF00297 * Ribosomal_L3 6.4e-45 38.1 197/263  
:BLT:SWISS 1->215 RL3_NITOC e-121 100.0 %
:PROS 104->127|PS00474|RIBOSOMAL_L3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58782.1 GT:GENE ABA58782.1 GT:PRODUCT LSU ribosomal protein L3P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2664190..2664837) GB:FROM 2664190 GB:TO 2664837 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L3P GB:PROTEIN_ID ABA58782.1 GB:DB_XREF GI:76884101 InterPro:IPR000597 LENGTH 215 SQ:AASEQ MAIGLIGRKVGMTRVFTDEGASIPVTVIEATPNRISQVKTLEQDGYQAVQVTVGERRPARVTSSLKGHFAKANVEPGRKLQEFRFGAEEGRDIKASGELKVDLFEVGQKVDVTGITRGRGFAGVVRRYHFGGGDASHGNSLSHRAPGSIGQCQTPGRVFKGKKMAGQMGNVRRTVQNLELVRIDEGRQLLLIKGAIPGAPGGDVIVKPAVKTVVK GT:EXON 1|1-215:0| SW:ID RL3_NITOC SW:DE RecName: Full=50S ribosomal protein L3; SW:GN Name=rplC; OrderedLocusNames=Noc_2324; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->215|RL3_NITOC|e-121|100.0|215/215| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 104->127|PS00474|RIBOSOMAL_L3|PDOC00385| BL:PDB:NREP 1 BL:PDB:REP 3->211|1vs6D|8e-73|63.3|207/209| RP:PDB:NREP 1 RP:PDB:REP 57->211|3bboF|3e-12|42.5|153/154| RP:PFM:NREP 1 RP:PFM:REP 9->198|PF00297|2e-45|56.1|187/196|Ribosomal_L3| HM:PFM:NREP 1 HM:PFM:REP 9->207|PF00297|6.4e-45|38.1|197/263|Ribosomal_L3| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00297|IPR000597| GO:PFM GO:0005622|"GO:intracellular"|PF00297|IPR000597| GO:PFM GO:0005840|"GO:ribosome"|PF00297|IPR000597| GO:PFM GO:0006412|"GO:translation"|PF00297|IPR000597| RP:SCP:NREP 1 RP:SCP:REP 3->211|1vs6D1|2e-72|62.8|207/209|b.43.3.2| HM:SCP:REP 1->215|1ffkB_|8.8e-80|55.1|214/337|b.43.3.2|1/1|Translation proteins| OP:NHOMO 1160 OP:NHOMOORG 1089 OP:PATTERN -----------------------1----------1------------------1-----------1-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111111112111111211111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22--111-3---1111111111111111111111111111111111111111111111111-111111-1111111111111111111-12111111111111111-1212221121--1111-1111-241-112111-1-1111111111-2-1111-111111-111111222122S2222232431221131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 97.2 SQ:SECSTR ##ccccccccccccccTTccccccccccccccccccccccccccccccccccccccccccccHHHHTTccccccccccccccccccccccTTTTcccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccTTTTTTccccccccccccccccccEEEEETTTTEEEEccccccccccccccccccc#### DISOP:02AL 131-145, 212-215| PSIPRED ccEEEEEEEEcccEEEcccccEEEEEEEEEccEEEEEEEEccccccEEEEEEEEccccccccHHHHHHHHHHccccHHEEEEEEEccccccccccccEEEEEEEccccEEEEEEEEccccEEccEEEccccccccccccccccccEEEccccccccEEEcccccccccccEEEEEEEEEEEEEcccccEEEEEcccccccccEEEEEcccccccc //