[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58786.1
DDBJ      :             SSU ribosomal protein S7P
Swiss-Prot:RS7_NITOC    RecName: Full=30S ribosomal protein S7;

Homologs  Archaea  31/68 : Bacteria  911/915 : Eukaryota  108/199 : Viruses  0/175   --->[See Alignment]
a.75.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->154 1vs7G PDBj 2e-58 69.7 %
:RPS:PDB   3->155 3bbnG PDBj 2e-50 43.8 %
:RPS:SCOP  3->156 1fjgG  a.75.1.1 * 7e-53 55.2 %
:HMM:SCOP  12->156 1rssA_ a.75.1.1 * 2.8e-59 68.3 %
:RPS:PFM   14->149 PF00177 * Ribosomal_S7 3e-39 66.2 %
:HMM:PFM   1->149 PF00177 * Ribosomal_S7 4.2e-65 64.2 148/148  
:BLT:SWISS 1->156 RS7_NITOC 8e-86 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58786.1 GT:GENE ABA58786.1 GT:PRODUCT SSU ribosomal protein S7P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2668567..2669037) GB:FROM 2668567 GB:TO 2669037 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S7P GB:PROTEIN_ID ABA58786.1 GB:DB_XREF GI:76884105 InterPro:IPR000235 InterPro:IPR005717 LENGTH 156 SQ:AASEQ MPRKRVIARREVLPDPKYGSVQLAKFITILMLSGKKSLAERIIYGALGRVSEKANQDPMDVLEKALENVRPLVEVKSRRVGGATYQVPVEVRPERRSTLAMRWLVEAARKRSEKSMDLRLAGELLDAHEGKGTAVKKREDTHRMAEANKAFAHYRW GT:EXON 1|1-156:0| SW:ID RS7_NITOC SW:DE RecName: Full=30S ribosomal protein S7; SW:GN Name=rpsG; OrderedLocusNames=Noc_2328; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|RS7_NITOC|8e-86|100.0|156/156| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 3->154|1vs7G|2e-58|69.7|152/152| RP:PDB:NREP 1 RP:PDB:REP 3->155|3bbnG|2e-50|43.8|153/154| RP:PFM:NREP 1 RP:PFM:REP 14->149|PF00177|3e-39|66.2|136/145|Ribosomal_S7| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF00177|4.2e-65|64.2|148/148|Ribosomal_S7| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00177|IPR000235| GO:PFM GO:0005622|"GO:intracellular"|PF00177|IPR000235| GO:PFM GO:0005840|"GO:ribosome"|PF00177|IPR000235| GO:PFM GO:0006412|"GO:translation"|PF00177|IPR000235| RP:SCP:NREP 1 RP:SCP:REP 3->156|1fjgG|7e-53|55.2|154/155|a.75.1.1| HM:SCP:REP 12->156|1rssA_|2.8e-59|68.3|142/145|a.75.1.1|1/1|Ribosomal protein S7| OP:NHOMO 1090 OP:NHOMOORG 1050 OP:PATTERN --11-111111111111-111111-------1111---------1-1--------------111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1-----111-----111---------------------------------------11111111111211111111111111--21-1----1--111-1-1--2211212111-11121121161-11311111-11111-111111--1111111111-111411112-1-----1--31E-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 99.4 SQ:SECSTR #ccccccccccccccTTTccccGGGHHHHcccTTcHHHHHHHHcHHHHTTTTTccccTTHHHHHHGGGTcccEEEccEEETTEEEccEEEccHHHHHHHHTTHHHHHHHTcccccHHHHHHHHHHHHHHTcHHHHHHHHHHHHHccccGGGccccc DISOP:02AL 1-6, 8-10| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEEEEcccEEEEcEEEcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHcccc //