[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58790.1
DDBJ      :             LSU ribosomal protein L12P
Swiss-Prot:RL7_NITOC    RecName: Full=50S ribosomal protein L7/L12;

Homologs  Archaea  0/68 : Bacteria  851/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
a.108.1d.45.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->105 1rquA PDBj 1e-24 73.7 %
:RPS:PDB   5->126 1dd3A PDBj 2e-22 54.9 %
:RPS:SCOP  5->34 1dd3A1  a.108.1.1 * 1e-05 43.3 %
:RPS:SCOP  59->126 1ctfA  d.45.1.1 * 2e-17 69.1 %
:HMM:SCOP  3->62 1dd3A1 a.108.1.1 * 1.3e-17 68.4 %
:HMM:SCOP  59->126 1ctfA_ d.45.1.1 * 9.6e-26 67.6 %
:RPS:PFM   60->126 PF00542 * Ribosomal_L12 1e-11 70.1 %
:HMM:PFM   59->126 PF00542 * Ribosomal_L12 7.1e-36 73.5 68/68  
:HMM:PFM   12->59 PF00428 * Ribosomal_60s 3.5e-06 35.4 48/88  
:BLT:SWISS 1->126 RL7_NITOC 3e-50 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58790.1 GT:GENE ABA58790.1 GT:PRODUCT LSU ribosomal protein L12P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2678207..2678587) GB:FROM 2678207 GB:TO 2678587 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L12P GB:PROTEIN_ID ABA58790.1 GB:DB_XREF GI:76884109 InterPro:IPR000206 LENGTH 126 SQ:AASEQ MAVAKEEILETISNMTVMDVVELIEAMEEKFGVSAAAPIAAAAPAAGAEAGAAAEEKTEFDVVLVSFGSNKVQVIKAVRSITSLGLKEAKDLVEGAPSPVKEGISKDEADEIKKQLEEAGASIEVK GT:EXON 1|1-126:0| SW:ID RL7_NITOC SW:DE RecName: Full=50S ribosomal protein L7/L12; SW:GN Name=rplL; OrderedLocusNames=Noc_2332; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->126|RL7_NITOC|3e-50|100.0|126/126| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 35->55|aaapiaaaapaagaeagaaae| BL:PDB:NREP 1 BL:PDB:REP 2->105|1rquA|1e-24|73.7|99/120| RP:PDB:NREP 1 RP:PDB:REP 5->126|1dd3A|2e-22|54.9|122/128| RP:PFM:NREP 1 RP:PFM:REP 60->126|PF00542|1e-11|70.1|67/68|Ribosomal_L12| HM:PFM:NREP 2 HM:PFM:REP 59->126|PF00542|7.1e-36|73.5|68/68|Ribosomal_L12| HM:PFM:REP 12->59|PF00428|3.5e-06|35.4|48/88|Ribosomal_60s| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00542|IPR013823| GO:PFM GO:0005622|"GO:intracellular"|PF00542|IPR013823| GO:PFM GO:0005840|"GO:ribosome"|PF00542|IPR013823| GO:PFM GO:0006412|"GO:translation"|PF00542|IPR013823| RP:SCP:NREP 2 RP:SCP:REP 5->34|1dd3A1|1e-05|43.3|30/57|a.108.1.1| RP:SCP:REP 59->126|1ctfA|2e-17|69.1|68/68|d.45.1.1| HM:SCP:REP 3->62|1dd3A1|1.3e-17|68.4|57/57|a.108.1.1|1/1|Ribosomal protein L7/12, oligomerisation (N-terminal) domain| HM:SCP:REP 59->126|1ctfA_|9.6e-26|67.6|68/68|d.45.1.1|1/1|ClpS-like| OP:NHOMO 935 OP:NHOMOORG 885 OP:PATTERN -------------------------------------------------------------------- 11111------111111----1111------11---111-111111-11111-1111-111111111111111111111111111111111111111-111111121111111111111-111111111111111111111111111111111111111-1111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---1--111-11111111-1111111111--11--1111-111111111111111111111111-111111111111111-111111111111111111111111111111111111111111111-1111111111111111111111111111111111211111111111111111111----------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1--11111----111111111-111111111111 11---1----------------------------------------1---------------11-------1---11-11----------------------------1-------1-------------------------------------------------------1-12222H--1-18345-62-211214 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 99.2 SQ:SECSTR #cccHHHHHHHHTTccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEcTTcHHHHHHHHHHHHcccHHHHHHHHTTTTcTEEEEEcHHHHHHHHHHHHHTTcEEEEc DISOP:02AL 41-53| PSIPRED ccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHccEEEEEEEcccccHHHHHHHHHHHccccHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHcccEEEEc //