[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58795.1
DDBJ      :             protein translocase subunit secE/sec61 gamma
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  117/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->78 3bo0B PDBj 6e-06 57.1 %
:RPS:PDB   62->115 3dinD PDBj 3e-09 18.5 %
:HMM:PFM   57->110 PF00584 * SecE 8.6e-23 48.1 54/57  
:BLT:SWISS 50->112 SECE_SALTY 9e-12 46.0 %
:PROS 59->87|PS01067|SECE_SEC61G
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58795.1 GT:GENE ABA58795.1 GT:PRODUCT protein translocase subunit secE/sec61 gamma GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2681236..2681583) GB:FROM 2681236 GB:TO 2681583 GB:DIRECTION - GB:PRODUCT protein translocase subunit secE/sec61 gamma GB:PROTEIN_ID ABA58795.1 GB:DB_XREF GI:76884114 InterPro:IPR001901 InterPro:IPR005807 LENGTH 115 SQ:AASEQ MADTIKLAVALLLLGTAIGLFYYFGDQSTLLRVLGLLAALGISLAILAKTTHGRAALSFAGETRVEFRKVVWPTRQETIRTTLLVLLMVMVMASILWLFDTLLMWAVRLLTGQGG GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 50->112|SECE_SALTY|9e-12|46.0|63/127| PROS 59->87|PS01067|SECE_SEC61G|PDOC00818| TM:NTM 3 TM:REGION 3->25| TM:REGION 31->53| TM:REGION 85->107| SEG 30->48|llrvlgllaalgislaila| SEG 83->92|llvllmvmvm| BL:PDB:NREP 1 BL:PDB:REP 51->78|3bo0B|6e-06|57.1|28/65| RP:PDB:NREP 1 RP:PDB:REP 62->115|3dinD|3e-09|18.5|54/56| HM:PFM:NREP 1 HM:PFM:REP 57->110|PF00584|8.6e-23|48.1|54/57|SecE| OP:NHOMO 117 OP:NHOMOORG 117 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1------------------------------------------------------------111------1--11111111111-111111---1---------11-11111111111111-111111111111111111111111--11111111111111111111111111-111111111111--1----------1--1------------------------------------------------------11-1-11111---11--------------11--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 56.5 SQ:SECSTR ##################################################cHHHHHHHHHHcHHHHHHHHHHHHcccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 115-116| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //