[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58799.1
DDBJ      :             Heat shock protein HslU
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  880/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:447 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   9->447 1do0A PDBj e-146 67.5 %
:RPS:PDB   7->447 1e94E PDBj 2e-32 63.1 %
:RPS:SCOP  9->447 1do0A  c.37.1.20 * 4e-51 66.5 %
:HMM:SCOP  8->447 1g41A_ c.37.1.20 * 2.4e-83 27.5 %
:RPS:PFM   56->110,252->332 PF07724 * AAA_2 3e-09 56.5 %
:RPS:PFM   339->408 PF10431 * ClpB_D2-small 3e-07 54.8 %
:HMM:PFM   190->333 PF07724 * AAA_2 2.4e-40 44.6 130/171  
:HMM:PFM   59->145 PF00004 * AAA 2.5e-09 25.6 86/130  
:HMM:PFM   339->409 PF10431 * ClpB_D2-small 1.6e-08 27.4 62/89  
:HMM:PFM   12->82 PF00493 * MCM 1.8e-06 25.0 68/326  
:BLT:SWISS 9->447 HSLU_METCA e-171 69.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58799.1 GT:GENE ABA58799.1 GT:PRODUCT Heat shock protein HslU GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2685411..2686754 GB:FROM 2685411 GB:TO 2686754 GB:DIRECTION + GB:PRODUCT Heat shock protein HslU GB:PROTEIN_ID ABA58799.1 GB:DB_XREF GI:76884118 InterPro:IPR003593 InterPro:IPR003959 InterPro:IPR004491 LENGTH 447 SQ:AASEQ MPELIPQQELTPRQIVQELDKHIIGQTAAKRAVAVALRNRWRRRQVSEELRNEITPKNILMIGPTGVGKTEIARRLAKLANAPFMKVEATKFTEVGYVGRDVESIIRDLVDIAIKITREQETAKVRNQAEDRAEERILDALLPAARAAPHDTMDEESNTRQKFRKMLREGRLDDREIEIELAAVSMGVEIMAPPGMEEMTSQLQNMFQNLGGTRTRARRLRVREAFKLLTEEEAGKLINDEDLKARSLENVEQNGIVFLDEMDKIAKRSEFSGTDVSREGVQRDLLPLVEGSAVSTKYGMVRTDHILFIASGAFHLAKPSDLIPEMQGRLPIRVELGALSVDDFVRILTEPNASLTEQYTALLKTEGISLHFTEEGIAHIAQIAWQVNERTENIGARRLHTVMERLLEGLSFEAENHTSKKVIIDAAYVDAQLADLARDEDLSRYIL GT:EXON 1|1-447:0| BL:SWS:NREP 1 BL:SWS:REP 9->447|HSLU_METCA|e-171|69.2|438/440| SEG 140->149|allpaaraap| SEG 210->223|lggtrtrarrlrvr| BL:PDB:NREP 1 BL:PDB:REP 9->447|1do0A|e-146|67.5|403/406| RP:PDB:NREP 1 RP:PDB:REP 7->447|1e94E|2e-32|63.1|406/408| RP:PFM:NREP 2 RP:PFM:REP 56->110,252->332|PF07724|3e-09|56.5|120/160|AAA_2| RP:PFM:REP 339->408|PF10431|3e-07|54.8|62/90|ClpB_D2-small| HM:PFM:NREP 4 HM:PFM:REP 190->333|PF07724|2.4e-40|44.6|130/171|AAA_2| HM:PFM:REP 59->145|PF00004|2.5e-09|25.6|86/130|AAA| HM:PFM:REP 339->409|PF10431|1.6e-08|27.4|62/89|ClpB_D2-small| HM:PFM:REP 12->82|PF00493|1.8e-06|25.0|68/326|MCM| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF07724|IPR013093| RP:SCP:NREP 1 RP:SCP:REP 9->447|1do0A|4e-51|66.5|403/406|c.37.1.20| HM:SCP:REP 8->447|1g41A_|2.4e-83|27.5|440/443|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1749 OP:NHOMOORG 1034 OP:PATTERN -------------------------------------------------------------------- 2221111111111111111-111111111111111111111111111111111111111111111121111111111111111222221111111121-11111112211111111111111111222222222221-111---1211111111111111111111111111111111111111112211-22222222232222222222222222222222222222222222222222222222222222222212212222211222221111111111111111111111111111111111111111111111111121111111111111111111111211111222222222222222222111221222222222222222222222222122222222-2222222222222222222222222222222222222222222222222212222222222222211222222222222222222222222222222222222222222222222222222221122222222211222223211122111111122222313332222222222211111112144344123221222222222222222222322222222222222222222222222222222222212233222222222222232222222222-22222222222222222222222222222222222222222222222222222222222222222112222222222242222222222222212222111111111132222222222222232222222222222122222222222222222222222212211232222222222222221--------------------------2222222222211 11--111-522-11111--11111-111111111111111111-11--1-1111---111111---11--11-1-11-111-----------1-1-1111-11222-14211111221-11-1122111171-11111112-111111-11112-21111212112-211B82132332G322116333-322244332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 48-51, 141-215, 264-281| PSIPRED cccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHcccEEEEEcccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccEEccccHHHHcccccccccccccccHHHHHHHHccccccccccEEccccccccccccccccccccccHHHHccccEEEEcccccHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccEEEEEHHHHHHHHHHHHHHcccHHHcc //