[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58800.1
DDBJ      :             Protein of unknown function DUF971
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:144 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  82->143 2nxoA1  c.94.1.1 * 3e-04 16.1 %
:RPS:PFM   31->112 PF06155 * DUF971 2e-22 53.7 %
:HMM:PFM   27->113 PF06155 * DUF971 2.9e-34 55.2 87/89  
:HMM:PFM   106->132 PF08424 * DUF1740 0.00044 40.7 27/236  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58800.1 GT:GENE ABA58800.1 GT:PRODUCT Protein of unknown function DUF971 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2686726..2687160 GB:FROM 2686726 GB:TO 2687160 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF971 GB:PROTEIN_ID ABA58800.1 GB:DB_XREF GI:76884119 InterPro:IPR010376 LENGTH 144 SQ:AASEQ MKTCHAISSREFSTLTMTIQHPHPQPTEIKLRRNSRVLEISFEDSAHFALPCEFLRVYSPSAEVRGHGPGQGILLIGKETVSIKEIEPVGHYAIKIRFDDGHDTGLYSWEYLYELGEKQTQLWQKYLDRLQQVGHSRKEPEIKD GT:EXON 1|1-144:0| RP:PFM:NREP 1 RP:PFM:REP 31->112|PF06155|2e-22|53.7|82/86|DUF971| HM:PFM:NREP 2 HM:PFM:REP 27->113|PF06155|2.9e-34|55.2|87/89|DUF971| HM:PFM:REP 106->132|PF08424|0.00044|40.7|27/236|DUF1740| GO:PFM:NREP 1 GO:PFM GO:0055114|"GO:oxidation reduction"|PF06155|IPR010376| RP:SCP:NREP 1 RP:SCP:REP 82->143|2nxoA1|3e-04|16.1|62/272|c.94.1.1| OP:NHOMO 180 OP:NHOMOORG 178 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------11111111111-12111111111-11111111111111111------------------1---111-----------------------------------------1111111-11111111-1111111111111111111111111111111111-11111111111111---------------------------------------------------------11-----1---1-1111111111111111111--111-1--------------------------------------------------------------------------------------------1---------1-111-------------------------1111111111111111111---------1----------------------------111-------------------------------------------------------- ----11--111--------------------------------------------------------------------------------------------------1------------------------------------------------------------------11-----1-1211-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 133-144| PSIPRED ccccccccccccEEEEEEEEccccccEEEEEEccccEEEEEEccccEEEEcHHHHHHHccccEEEEEEccccccccccccEEEEEEcccccEEEEEEEccccccccccHHHHHHHHccHHHHHHHHHHHHHHHccccccccccc //