[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58818.1
DDBJ      :             Flagellar hook-basal body complex protein FliE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  243/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->106 PF02049 * FliE 1e-11 50.5 %
:HMM:PFM   12->106 PF02049 * FliE 1.6e-34 46.8 94/97  
:BLT:SWISS 8->106 FLIE_NITEU 4e-22 48.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58818.1 GT:GENE ABA58818.1 GT:PRODUCT Flagellar hook-basal body complex protein FliE GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2705228..2705548) GB:FROM 2705228 GB:TO 2705548 GB:DIRECTION - GB:PRODUCT Flagellar hook-basal body complex protein FliE GB:PROTEIN_ID ABA58818.1 GB:DB_XREF GI:76884137 InterPro:IPR001624 LENGTH 106 SQ:AASEQ MESINSTQLLEQMRAATALAKNNSASTAGELPEGEFATLFRQAIDSVNQFQQQSSELQTAFVRGDSNVDLAEVMIASQKSTVSFQAALQVRNRLVSAYQEIMNMQI GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 8->106|FLIE_NITEU|4e-22|48.5|99/109| RP:PFM:NREP 1 RP:PFM:REP 15->106|PF02049|1e-11|50.5|91/98|FliE| HM:PFM:NREP 1 HM:PFM:REP 12->106|PF02049|1.6e-34|46.8|94/97|FliE| GO:PFM:NREP 4 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF02049|IPR001624| GO:PFM GO:0003774|"GO:motor activity"|PF02049|IPR001624| GO:PFM GO:0005198|"GO:structural molecule activity"|PF02049|IPR001624| GO:PFM GO:0009288|"GO:bacterial-type flagellum"|PF02049|IPR001624| OP:NHOMO 272 OP:NHOMOORG 244 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---1-111-1------1---------------------------------------------------------------------------------------------1-----11-1-1-1---1-----1--1------1------1----------------------------------------------------------------------------1111---------------------------------------------------111-11111---1111111111-11111--111111--22111131---111111111111-------111-111------------------11--------------------------------------12-1111111-1211121211121112221---1111------21111111111111111-1111111111111-11--1---11111111111111111111111--1111--122222222222---------1111--1-1-------------------------1111111111111111111---------1111211111221111111111112----------------------------------------------------1---1-1---- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 11-38, 48-62| PSIPRED cccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //