[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58821.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->108 PF05400 * FliT 1.3e-05 27.6 87/109  
:BLT:SWISS 12->102 POLG_ZYMVC 6e-04 26.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58821.1 GT:GENE ABA58821.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2709463..2709816) GB:FROM 2709463 GB:TO 2709816 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58821.1 GB:DB_XREF GI:76884140 LENGTH 117 SQ:AASEQ MTLSTVTERSVLETQGIEDILDTLLAISQKMLLKAQESAWQELAELQLERDEMLRYSFSQEQRLDTPSFPPQRLEHLLLLNEEIVTLCQQERDRFSQGVKELQRGSHACDIYRGYIF GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 12->102|POLG_ZYMVC|6e-04|26.4|91/100| HM:PFM:NREP 1 HM:PFM:REP 22->108|PF05400|1.3e-05|27.6|87/109|FliT| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccc //