[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58822.1
DDBJ      :             Flagellar protein FliS
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  294/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.19
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->124 1oryA PDBj 9e-09 30.8 %
:RPS:SCOP  22->124 1vh6A  a.24.19.1 * 7e-24 31.7 %
:HMM:SCOP  8->130 1orjA_ a.24.19.1 * 1.4e-34 46.3 %
:RPS:PFM   6->124 PF02561 * FliS 3e-26 54.8 %
:HMM:PFM   4->125 PF02561 * FliS 6.1e-31 41.0 117/122  
:BLT:SWISS 1->125 FLISB_PSEAE 2e-28 43.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58822.1 GT:GENE ABA58822.1 GT:PRODUCT Flagellar protein FliS GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2709834..2710280) GB:FROM 2709834 GB:TO 2710280 GB:DIRECTION - GB:PRODUCT Flagellar protein FliS GB:PROTEIN_ID ABA58822.1 GB:DB_XREF GI:76884141 InterPro:IPR003713 LENGTH 148 SQ:AASEQ MIQNRALQQYRQIGAQSAVTAADPHRLIQMLLEGALEKITVARGAIARNDITQKGVNIGEAIDIVSGLQASLNRERGAEIADNLDRLYDYIIGRLLEANLRNDVAILEEIACLLGEIKQGWEAISTMNTSIAVQEGGKAVSSSGINPR GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 1->125|FLISB_PSEAE|2e-28|43.2|125/126| BL:PDB:NREP 1 BL:PDB:REP 16->124|1oryA|9e-09|30.8|107/119| RP:PFM:NREP 1 RP:PFM:REP 6->124|PF02561|3e-26|54.8|115/121|FliS| HM:PFM:NREP 1 HM:PFM:REP 4->125|PF02561|6.1e-31|41.0|117/122|FliS| GO:PFM:NREP 2 GO:PFM GO:0009288|"GO:bacterial-type flagellum"|PF02561|IPR003713| GO:PFM GO:0009296|"GO:flagellum assembly"|PF02561|IPR003713| RP:SCP:NREP 1 RP:SCP:REP 22->124|1vh6A|7e-24|31.7|101/102|a.24.19.1| HM:SCP:REP 8->130|1orjA_|1.4e-34|46.3|121/0|a.24.19.1|1/1|Flagellar export chaperone FliS| OP:NHOMO 328 OP:NHOMOORG 294 OP:PATTERN -------------------------------------------------------------------- -11----------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------------------------------21---------------121111---1111-11---------------------------------------------------------------------------------------------------111-111111-11111--1---11---1-111---1---1-1111-----1-----------------------------------------------------------------------------------------------------------------------------111111111211111111111112121111111--111111111--11111111112--------111-1111--1-111111111----1111-------1----------------------1-----12-1121111-1211121211121122221---1111------21111111111111111-1211211111112-11--1---111111111111111111111111111111-121222121221---------1111--111-------------------------1211-11111311111111---------1111211111221111111111112-------1111111--------------------------------------111111-1-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 73.0 SQ:SECSTR ###############GGGGGGccHHHHHHHHHHHHHHHHHHHHHTGGGTTcHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHTcTTccHHHH#HHHHHHHHHHHHHHHHHH######################## DISOP:02AL 1-9, 126-142, 147-148| PSIPRED ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //