[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58831.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  487/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.152.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   143->222 1wlgA PDBj 2e-07 34.2 %
:RPS:PDB   164->253 3e66A PDBj 4e-21 12.2 %
:RPS:SCOP  111->221 1wlgA  b.152.1.1 * 7e-18 33.0 %
:HMM:SCOP  92->222 1wlgA_ b.152.1.1 * 2.4e-36 40.0 %
:RPS:PFM   5->35 PF00460 * Flg_bb_rod 1e-04 58.1 %
:RPS:PFM   222->255 PF06429 * DUF1078 8e-08 64.7 %
:HMM:PFM   223->254 PF06429 * DUF1078 1.6e-17 65.6 32/39  
:HMM:PFM   5->35 PF00460 * Flg_bb_rod 4.6e-17 51.6 31/31  
:BLT:SWISS 1->259 FLGG_ECOLI 3e-93 63.7 %
:PROS 11->31|PS00588|FLAGELLA_BB_ROD

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58831.1 GT:GENE ABA58831.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2721070..2721855) GB:FROM 2721070 GB:TO 2721855 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58831.1 GB:DB_XREF GI:76884150 InterPro:IPR001444 InterPro:IPR010930 LENGTH 261 SQ:AASEQ MNQALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPGAQSSQNTLLPSGLMLGTGVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQILMPDGSLAYTRDGTFQIDANGQLVTSSGYPVQPGITIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFINPAGLQPTGNNLFKETASSGVAQTGIPGLNGIGTLVQGALEGANVNVVEELVNMIETQRAYEMNSKAISSTDEMLRFATQTL GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 1->259|FLGG_ECOLI|3e-93|63.7|259/260| PROS 11->31|PS00588|FLAGELLA_BB_ROD|PDOC00508| BL:PDB:NREP 1 BL:PDB:REP 143->222|1wlgA|2e-07|34.2|79/293| RP:PDB:NREP 1 RP:PDB:REP 164->253|3e66A|4e-21|12.2|90/255| RP:PFM:NREP 2 RP:PFM:REP 5->35|PF00460|1e-04|58.1|31/31|Flg_bb_rod| RP:PFM:REP 222->255|PF06429|8e-08|64.7|34/39|DUF1078| HM:PFM:NREP 2 HM:PFM:REP 223->254|PF06429|1.6e-17|65.6|32/39|DUF1078| HM:PFM:REP 5->35|PF00460|4.6e-17|51.6|31/31|Flg_bb_rod| GO:PFM:NREP 5 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF00460|IPR001444| GO:PFM GO:0003774|"GO:motor activity"|PF00460|IPR001444| GO:PFM GO:0005198|"GO:structural molecule activity"|PF00460|IPR001444| GO:PFM GO:0009288|"GO:bacterial-type flagellum"|PF00460|IPR001444| GO:PFM GO:0019861|"GO:flagellum"|PF06429|IPR010930| RP:SCP:NREP 1 RP:SCP:REP 111->221|1wlgA|7e-18|33.0|103/293|b.152.1.1| HM:SCP:REP 92->222|1wlgA_|2.4e-36|40.0|130/0|b.152.1.1|1/1|Flagellar hook protein flgE| OP:NHOMO 1572 OP:NHOMOORG 490 OP:PATTERN -------------------------------------------------------------------- 3331------------------------------------1---1---1--1-1--------1-1------------------33333--------------------3------------------------------------3---------------------------------------------333222222221222222333323222333333322222233------------------------------------------------------------------------------------------33333333333343433333---333--23332333333332333331--33323333----336253344733633323333332-5565536733233333433444334-3333335655233---------223-465--------------------------------333332333444733333333433336364333333--533333333--363333333363-------333-33333-3344446445433333333333-3--3-4344-4444443333333334443---36-333333333633383633363366663---333321-22263333333333333333-3633633233336233333---3333333333333333333333321223233356666666663---------3333--533-------------------------3333333333633333444---------3222522222552223333333336------333333333333333333--------------------------3-33333233-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 42.5 SQ:SECSTR ##############################################################################################################################################cccEEEEEEcTTcEEEEEETTTTTGGGGGccccEEEEEcTTccEEEEEEcTTccEEEEEEcEEEEEGGGTTTcccHHHHHHHHHHHHHHHHHHHccGGGcccEEEEccGGG######## DISOP:02AL 1-2, 47-63| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccHHHHHHHHHHcccccccccccccccccEEcccEEEEEEEEEcccccEEEccccEEEEEcccEEEEEEcccccEEEEccccEEEcccccEEEccccEEcccccccccccEEEEccccEEEEEEcccccEEEEEEEEEEEEccHHHcEEccccEEEEcccccccccccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //