[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58835.1
DDBJ      :             Flagellar basal-body rod protein FlgC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  457/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->127 3e66A PDBj 2e-13 12.4 %
:HMM:PFM   97->135 PF06429 * DUF1078 1.5e-14 41.0 39/39  
:HMM:PFM   7->32 PF00460 * Flg_bb_rod 2.5e-10 38.5 26/31  
:BLT:SWISS 1->137 FLGC_ECOLI 9e-33 51.5 %
:PROS 13->33|PS00588|FLAGELLA_BB_ROD

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58835.1 GT:GENE ABA58835.1 GT:PRODUCT Flagellar basal-body rod protein FlgC GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2724655..2725068) GB:FROM 2724655 GB:TO 2725068 GB:DIRECTION - GB:PRODUCT Flagellar basal-body rod protein FlgC GB:PROTEIN_ID ABA58835.1 GB:DB_XREF GI:76884154 InterPro:IPR001444 InterPro:IPR006299 InterPro:IPR010930 LENGTH 137 SQ:AASEQ MSLFKVFDIAGTAMSAQTLRLNTTASNLANADSVSSSIDQTYRARQPVFATLLDKFNPEAPAGGVQVLGVVESGAPLQQEYAPDHPMANEAGYIFHPNVNSIEEMANMISASRNYENNVEMANTSKQLLLRTLQLGE GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 1->137|FLGC_ECOLI|9e-33|51.5|134/134| PROS 13->33|PS00588|FLAGELLA_BB_ROD|PDOC00508| RP:PDB:NREP 1 RP:PDB:REP 23->127|3e66A|2e-13|12.4|105/255| HM:PFM:NREP 2 HM:PFM:REP 97->135|PF06429|1.5e-14|41.0|39/39|DUF1078| HM:PFM:REP 7->32|PF00460|2.5e-10|38.5|26/31|Flg_bb_rod| OP:NHOMO 507 OP:NHOMOORG 458 OP:PATTERN -------------------------------------------------------------------- -111------------------------------------1---1---1----1-----------------------------11111--------------------1------------------------------------1----------------------------------------------111111111111111111111111111111111------11------------------------------------------------------------------------------------------1111111111-111111111---111--11111111111111111111---1111111----112111111211211111111111-1121112211111111111111111-1-11--2222-1---------1111-121--------------------------------111111111111211111111111112121111111--111111111--121111111121-------111-11111-1111111111112111111111-1--1-111--------1-1111111-1-1---12-111111111211131211121122221---111111-11121111111111111111-1211211111112111111---1111111111111111111111111---111122222222222---------1111--211-------------------------1111111111211111111---------1111211111221111111111112------111111111111111111--------------------------1-11111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 76.6 SQ:SECSTR ######################ccTTTGGGGGccccEEEEEcTTccEEEEEEcTTccEEEEEEcEEEEEEcTTTcEEEEEEEcGGGTTTcccHHHHHHHHHHHHHHHHHHHccGGGcccEEEEccGG########## DISOP:02AL 50-69, 76-87| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEHHHHcccccccccccEEEEEEEccccccEEEEcccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //