[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58844.1
DDBJ      :             conserved hypothetical protein, YCII-related
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  232/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:99 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->97 1mwqB PDBj 1e-30 57.9 %
:RPS:PDB   1->95 3dcaA PDBj 5e-10 18.9 %
:RPS:SCOP  3->98 1mwqA  d.58.4.7 * 3e-25 57.3 %
:HMM:SCOP  1->98 1mwqA_ d.58.4.7 * 1.3e-31 51.0 %
:RPS:PFM   3->85 PF03795 * YCII 6e-09 41.0 %
:HMM:PFM   1->95 PF03795 * YCII 8.7e-29 35.8 95/95  
:BLT:SWISS 1->97 YCII_SHIFL 5e-32 62.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58844.1 GT:GENE ABA58844.1 GT:PRODUCT conserved hypothetical protein, YCII-related GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2734257..2734556 GB:FROM 2734257 GB:TO 2734556 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein, YCII-related GB:PROTEIN_ID ABA58844.1 GB:DB_XREF GI:76884163 InterPro:IPR005545 LENGTH 99 SQ:AASEQ MLYAIIGQDIDHSLERRRQVRSEHLARIRKLQENGHLVLAGPFPALDTQDPGEAGFTGSLIVAEFSSLEAAQQWAEADPYVEAGVYAQVTVKPFKQVLP GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 1->97|YCII_SHIFL|5e-32|62.9|97/98| BL:PDB:NREP 1 BL:PDB:REP 3->97|1mwqB|1e-30|57.9|95/98| RP:PDB:NREP 1 RP:PDB:REP 1->95|3dcaA|5e-10|18.9|90/127| RP:PFM:NREP 1 RP:PFM:REP 3->85|PF03795|6e-09|41.0|83/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 1->95|PF03795|8.7e-29|35.8|95/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 3->98|1mwqA|3e-25|57.3|96/100|d.58.4.7| HM:SCP:REP 1->98|1mwqA_|1.3e-31|51.0|98/100|d.58.4.7|1/1|Dimeric alpha+beta barrel| OP:NHOMO 233 OP:NHOMOORG 233 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-1----1------1-1111--1------------1-------------------------------------------111111----------------------------1-----------11111111111111111111------------------------1--------------------------------111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111---1111111111111111111111111-111111111111---11-1------1111111111111111111111111111111111111111111111111---------1111111111111111111111111------1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccTTccccccccHHHHHHHHHHHHHTcEEEEEEcccccccTTccTTccccEEEEEEEccHHHHHHHTcHHHHHHHHEEEEEEEccccTGGG PSIPRED cEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccEEEEEEEEccHHHHHHHHHcccHHHccEEEEEEEEEEEEccc //