[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58848.1
DDBJ      :             AcfC-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->245 3firA PDBj 4e-35 35.5 %
:RPS:PDB   20->247 1atgA PDBj 1e-13 14.3 %
:RPS:SCOP  97->255 1sbpA  c.94.1.1 * 2e-16 22.9 %
:HMM:SCOP  17->245 1sbpA_ c.94.1.1 * 1.2e-32 25.7 %
:HMM:PFM   32->91 PF01547 * SBP_bac_1 1.9e-05 26.7 60/314  
:HMM:PFM   91->183 PF00497 * SBP_bac_3 7.3e-05 27.8 79/225  
:BLT:SWISS 102->245 SUBI_SYNE7 3e-04 25.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58848.1 GT:GENE ABA58848.1 GT:PRODUCT AcfC-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2737869..2738648) GB:FROM 2737869 GB:TO 2738648 GB:DIRECTION - GB:PRODUCT AcfC-like protein GB:PROTEIN_ID ABA58848.1 GB:DB_XREF GI:76884167 InterPro:IPR011587 LENGTH 259 SQ:AASEQ MKFLSLIMMWALVFSAHGVELYVYGPGGPAPAMKAAAAAFEKASGTKVVVTAGPTPTWIEAARGNADLLYSGSEHMMSDFLLILGSMLAADTVRPMYLRPAAILVRPGNPAGISGLADLLKPGRRVLVVHGAGQVGLWEDIVGRGGDITTLRALRGNIVHYATNTGAAKERWLTDPKIDAWIVYNIWAIANPGIADVIPLEPHYRIYRDCGIVFTERSRTKPEAQAFTRFLEGDEGRAIFERFGWMRRDTAVSAANEGS GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 102->245|SUBI_SYNE7|3e-04|25.7|144/100| TM:NTM 1 TM:REGION 1->23| SEG 25->39|gpggpapamkaaaaa| BL:PDB:NREP 1 BL:PDB:REP 40->245|3firA|4e-35|35.5|203/231| RP:PDB:NREP 1 RP:PDB:REP 20->247|1atgA|1e-13|14.3|224/231| HM:PFM:NREP 2 HM:PFM:REP 32->91|PF01547|1.9e-05|26.7|60/314|SBP_bac_1| HM:PFM:REP 91->183|PF00497|7.3e-05|27.8|79/225|SBP_bac_3| RP:SCP:NREP 1 RP:SCP:REP 97->255|1sbpA|2e-16|22.9|157/309|c.94.1.1| HM:SCP:REP 17->245|1sbpA_|1.2e-32|25.7|226/309|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 31 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------1---------------------1------------------------1--------------------------------------------1----------2222-2-------------------------------------------------1-----------------11--------1---------1-----------------------------------------------------------------------------------------1-------------------------------------1--111111----------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 91.1 SQ:SECSTR ###################cEEEEEEGGGHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHTTccccEEEccccHHHHHHHHHHTTcccTTccEEEEEccEEEEEccTTTccTTcGGGGccccccEEEEcTTHHHHHHHHHHHTTcHHHHHHTTcEEEEccHHHHHHHHHTTcccEEEEEGGGTccTTcccccEEEcccGGGccccEEEEEEEEcTTcccHHHHHHHHHHTTcHHHHHHHHHTTcccEEccEEcc#### DISOP:02AL 253-259| PSIPRED cHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEEccHHHHHHHHHHccccccccccEEEEcccEEEEEccccccccccHHHHcccccEEEEcccccHHHHHHHHHHHcccHHHHHHHHccccEEEccHHHHHHHHHHHccccEEEEEHHHHHHcccEEEEEEEcccccEEccccEEEEcccccHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHcccc //