[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58880.1
DDBJ      :             Ferric-uptake regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  340/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->157 3eyyA PDBj 5e-10 37.9 %
:RPS:PDB   36->104 1dpuA PDBj 3e-06 26.2 %
:RPS:SCOP  28->159 1mzbA  a.4.5.42 * 2e-22 19.1 %
:HMM:SCOP  26->159 1mzbA_ a.4.5.42 * 3.9e-31 32.3 %
:RPS:PFM   36->153 PF01475 * FUR 4e-16 35.0 %
:HMM:PFM   35->153 PF01475 * FUR 1.5e-16 30.4 115/120  
:BLT:SWISS 25->160 ZUR_SHIFL 3e-26 44.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58880.1 GT:GENE ABA58880.1 GT:PRODUCT Ferric-uptake regulator GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2771165..2771656) GB:FROM 2771165 GB:TO 2771656 GB:DIRECTION - GB:PRODUCT Ferric-uptake regulator GB:PROTEIN_ID ABA58880.1 GB:DB_XREF GI:76884199 InterPro:IPR002481 LENGTH 163 SQ:AASEQ MSHTNILVPFKGPSHDHWRCIRNALAVAEKTCASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEHQAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAKYLGFRVDRQTVEIRGLCPQCSGD GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 25->160|ZUR_SHIFL|3e-26|44.1|136/171| BL:PDB:NREP 1 BL:PDB:REP 35->157|3eyyA|5e-10|37.9|116/133| RP:PDB:NREP 1 RP:PDB:REP 36->104|1dpuA|3e-06|26.2|65/69| RP:PFM:NREP 1 RP:PFM:REP 36->153|PF01475|4e-16|35.0|117/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 35->153|PF01475|1.5e-16|30.4|115/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 28->159|1mzbA|2e-22|19.1|131/133|a.4.5.42| HM:SCP:REP 26->159|1mzbA_|3.9e-31|32.3|133/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 352 OP:NHOMOORG 340 OP:PATTERN -------------------------------------------------------------------- -------1-------------1----------------11---2---1-------------1----1-1------111----1--111------------------------------------------------11111---111--------------1----------1-----1--1-------------------------------------11--11-------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111211111111111111-11111211111-1111111111111111111111111111111111111111111------------------------------1111111111111111111111122111111112--------------1-------1----111111111---------------------1-------------------------------------------111-1211211----------1--------1-11111------21111111111111111-1111111111111111111112111111111111111111111111111111-11111111111111-------111111311---------------11111111111111111111111111111111111111-111111111111-111111111111111--1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 79.1 SQ:SECSTR ################################TcTcccccHHHHHHHHHHHHcTTTEEHHHHHHHcHHHcTTccHHHHHHHHHHHHHTTcEEEcccTTEEEEccccccccHHHHHHTcccccEEEccEEccHHHHHHHHHHTccccccccccEEEccTTTH## DISOP:02AL 1-3, 162-163| PSIPRED cccccEEEEccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccEEEEEcccccccEEEEEEccccEEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEccccccc //