[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58888.1
DDBJ      :             Aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  273/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   35->295 3csvA PDBj 9e-23 36.7 %
:RPS:PDB   42->260 1avqA PDBj 1e-31 9.9 %
:RPS:SCOP  19->242 1nd4A  d.144.1.6 * 3e-13 14.9 %
:HMM:SCOP  1->265 1j7lA_ d.144.1.6 * 9.3e-29 23.2 %
:RPS:PFM   164->221 PF01636 * APH 3e-06 46.6 %
:HMM:PFM   25->242 PF01636 * APH 4.1e-31 30.0 210/238  
:BLT:SWISS 10->87 KAIN_PONAB 1e-04 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58888.1 GT:GENE ABA58888.1 GT:PRODUCT Aminoglycoside phosphotransferase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2778951..2779922) GB:FROM 2778951 GB:TO 2779922 GB:DIRECTION - GB:PRODUCT Aminoglycoside phosphotransferase GB:PROTEIN_ID ABA58888.1 GB:DB_XREF GI:76884207 InterPro:IPR002575 LENGTH 323 SQ:AASEQ MSDPRFDALQQWLERGLGLMNYRLAPASEDASFRRYFRVYYRGMSLIVMDAPPEREDCRSFVHVARGFRGLGLNVPEVLEQDLERGFLLLTDLGEHQYLRVLNARNASTLYRDALVALRLLQGGENAQGLHLPPYDQDLLLKEMGLFQEWYLERHLGIEVGTTLEKVFERLAASALAQPQVPVHRDYHSRNLMMTEQANPGVLDFQDAVKGPVTYDLVSLLRDCYIAWPQDRVLVWLYDYRRQAARAGIPVGASEAEFLRWFDWMGVQRHLKASGIFARLNVRDKKSGYLKDIPRTLGYIRTVARRYGELAELDGVLRDFSNQ GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 10->87|KAIN_PONAB|1e-04|34.2|76/427| BL:PDB:NREP 1 BL:PDB:REP 35->295|3csvA|9e-23|36.7|248/316| RP:PDB:NREP 1 RP:PDB:REP 42->260|1avqA|1e-31|9.9|212/228| RP:PFM:NREP 1 RP:PFM:REP 164->221|PF01636|3e-06|46.6|58/221|APH| HM:PFM:NREP 1 HM:PFM:REP 25->242|PF01636|4.1e-31|30.0|210/238|APH| RP:SCP:NREP 1 RP:SCP:REP 19->242|1nd4A|3e-13|14.9|222/255|d.144.1.6| HM:SCP:REP 1->265|1j7lA_|9.3e-29|23.2|250/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 273 OP:NHOMOORG 273 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------11-1-------------------------------111111111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1-111111111111111111111111-11111111111-111111111111111111-11111111------------11-1-----------------------------11111-1111111111111111111111111111111111111111111111111111111111111111111111111111-------------------111111-1--------------------1---111111-11-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111---------1--------------111111111111111-1-111111------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 291 STR:RPRED 90.1 SQ:SECSTR ######TTTHHHHHHHccTHHHHccGGGccccccEEEEEEcHHHHHHcccGGGccTTcHHHHHTTTTcETTTGGGTTccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEccccEEccTTccEEcEEETTccEEEEEccccHHHHHHHHHHcGGGccHHHHHHHHHHHHHHcTccEEEEEEEcTTcccccEEEEEEEccHHHHHHHHHHHHHHHHHHGcccHHHHHTTccTTGGGcHHGGGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHH########################## PSIPRED cccHHHHHHHHHHHHHccccccEEEEccccccccEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHcccccHHHHHccccccEEEEEcccccHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccHHccccccHHHHHHHHHHHHHHHccccEEEEcccccccEEEccccEEEEEEEcccEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccc //