[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58893.1
DDBJ      :             Sigma 54 modulation protein/ribosomal protein S30EA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.40.4d.204.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->99 1n3gA PDBj 3e-05 29.4 %
:BLT:PDB   119->178 1i5fA PDBj 1e-07 38.3 %
:RPS:PDB   119->178 1c9oA PDBj 6e-09 38.3 %
:RPS:SCOP  5->115 1imuA  d.204.1.1 * 8e-16 19.2 %
:RPS:SCOP  119->178 1c9oA  b.40.4.5 * 4e-09 38.3 %
:HMM:SCOP  4->127 1l4sA_ d.204.1.1 * 5.2e-22 22.3 %
:HMM:SCOP  109->182 1h95A_ b.40.4.5 * 6.9e-13 25.7 %
:RPS:PFM   4->105 PF02482 * Ribosomal_S30AE 8e-15 44.7 %
:RPS:PFM   118->178 PF00313 * CSD 5e-07 39.3 %
:HMM:PFM   5->109 PF02482 * Ribosomal_S30AE 8.4e-15 30.1 93/94  
:HMM:PFM   119->179 PF00313 * CSD 2.1e-12 34.4 61/67  
:BLT:SWISS 3->107 RP5M_PSEPU 2e-08 31.2 %
:BLT:SWISS 118->178 CSPE_BACCR 2e-09 41.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58893.1 GT:GENE ABA58893.1 GT:PRODUCT Sigma 54 modulation protein/ribosomal protein S30EA GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2784783..2785331 GB:FROM 2784783 GB:TO 2785331 GB:DIRECTION + GB:PRODUCT Sigma 54 modulation protein/ribosomal protein S30EA GB:PROTEIN_ID ABA58893.1 GB:DB_XREF GI:76884212 InterPro:IPR002059 InterPro:IPR003489 LENGTH 182 SQ:AASEQ MQLPIQISFRHMEPSLAVEDKIRKKAAKLEQFHDRIMGCRVVVEAPHQHHHQGKLYHVRIDLTVPGGELVVSREHHGKQAHQDVYVAIRDAFNAAQRQLESHIQRQRGHVKYHEPPPSGRISVLVPEQDYGKIETIDGREIYFHKNSILNGGFKELKVGNEVHFIEEEGDLGPQASTVHIKN GT:EXON 1|1-182:0| BL:SWS:NREP 2 BL:SWS:REP 3->107|RP5M_PSEPU|2e-08|31.2|93/102| BL:SWS:REP 118->178|CSPE_BACCR|2e-09|41.0|61/67| BL:PDB:NREP 2 BL:PDB:REP 3->99|1n3gA|3e-05|29.4|85/113| BL:PDB:REP 119->178|1i5fA|1e-07|38.3|60/66| RP:PDB:NREP 1 RP:PDB:REP 119->178|1c9oA|6e-09|38.3|60/66| RP:PFM:NREP 2 RP:PFM:REP 4->105|PF02482|8e-15|44.7|94/98|Ribosomal_S30AE| RP:PFM:REP 118->178|PF00313|5e-07|39.3|61/67|CSD| HM:PFM:NREP 2 HM:PFM:REP 5->109|PF02482|8.4e-15|30.1|93/94|Ribosomal_S30AE| HM:PFM:REP 119->179|PF00313|2.1e-12|34.4|61/67|CSD| GO:PFM:NREP 4 GO:PFM GO:0005488|"GO:binding"|PF02482|IPR003489| GO:PFM GO:0044238|"GO:primary metabolic process"|PF02482|IPR003489| GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 2 RP:SCP:REP 5->115|1imuA|8e-16|19.2|99/107|d.204.1.1| RP:SCP:REP 119->178|1c9oA|4e-09|38.3|60/66|b.40.4.5| HM:SCP:REP 4->127|1l4sA_|5.2e-22|22.3|112/112|d.204.1.1|1/1|Ribosome binding protein Y (YfiA homologue)| HM:SCP:REP 109->182|1h95A_|6.9e-13|25.7|74/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 54 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----21-------------------------------2--------------------------------------1----1-1-----------------------------------------------1111----111111---------11-------1-1-----1--------------1-------1-------------------11111111--------------------------------1----1----------------------1--1---------------------------------------------------------------------------------------------1111111112-----------------------------11------------------------------------------------------------------------------------------------------------------ -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 90.1 SQ:SECSTR ##cccEEccccccccHHHHHHHHHHHHHHTTccccccEEEEEEEEETTE######EEEEEEEEETTEEEEEE####EE##EccHHHHHHHHHHHHHHHH###HHHHHHHHHTTTccEcEEEEEEETTTTEEEEEETTEEEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEc# DISOP:02AL 1-3, 102-120, 176-177| PSIPRED cccccEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEEEcccEEEEEcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccEEEEccccccEEEEEEEEcccccccccccccEEEEEEEEcccccEEEEEEEEc //