[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58925.1
DDBJ      :             succinate dehydrogenase subunit D
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.2
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   35->82 2wdqD PDBj 1e-07 33.3 %
:RPS:SCOP  2->100 1nekD  f.21.2.2 * 1e-10 27.3 %
:HMM:SCOP  2->106 1nekD_ f.21.2.2 * 3.2e-19 34.3 %
:HMM:PFM   3->91 PF01127 * Sdh_cyt 5.2e-15 30.7 88/121  
:BLT:SWISS 35->82 DHSD_SHIFL 4e-07 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58925.1 GT:GENE ABA58925.1 GT:PRODUCT succinate dehydrogenase subunit D GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2817652..2817969) GB:FROM 2817652 GB:TO 2817969 GB:DIRECTION - GB:PRODUCT succinate dehydrogenase subunit D GB:PROTEIN_ID ABA58925.1 GB:DB_XREF GI:76884244 LENGTH 105 SQ:AASEQ MTGLRAWLVQRGTAVIMLVLLLFFLARLMQGSFKTYEAWREWISDPLVSIMVALFFGVLLLHSWVGLRDIILDYVRPVSLRLFAHSLIVVVYSGIGFWVIRILLR GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 35->82|DHSD_SHIFL|4e-07|33.3|48/115| TM:NTM 3 TM:REGION 6->28| TM:REGION 47->69| TM:REGION 81->103| SEG 14->29|avimlvlllfflarlm| BL:PDB:NREP 1 BL:PDB:REP 35->82|2wdqD|1e-07|33.3|48/105| HM:PFM:NREP 1 HM:PFM:REP 3->91|PF01127|5.2e-15|30.7|88/121|Sdh_cyt| RP:SCP:NREP 1 RP:SCP:REP 2->100|1nekD|1e-10|27.3|99/113|f.21.2.2| HM:SCP:REP 2->106|1nekD_|3.2e-19|34.3|105/0|f.21.2.2|1/1|Fumarate reductase respiratory complex transmembrane subunits| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1---11---------1-1------1111111-1-111--------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 45.7 SQ:SECSTR ##################################cHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHH####################### PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEc //