[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58938.1
DDBJ      :             Protein of unknown function DUF59
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  341/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->182 1uwdA PDBj 3e-13 34.8 %
:RPS:PDB   81->181 3cq2B PDBj 9e-24 32.6 %
:RPS:SCOP  78->182 1uwdA  d.52.8.2 * 1e-21 31.7 %
:HMM:SCOP  77->182 1uwdA_ d.52.8.2 * 1.1e-24 37.3 %
:RPS:PFM   88->161 PF01883 * DUF59 6e-11 42.9 %
:HMM:PFM   86->160 PF01883 * DUF59 3e-21 43.7 71/76  
:BLT:SWISS 79->182 YITW_BACSU 2e-13 35.0 %
:PROS 161->167|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58938.1 GT:GENE ABA58938.1 GT:PRODUCT Protein of unknown function DUF59 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2831427..2831978) GB:FROM 2831427 GB:TO 2831978 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF59 GB:PROTEIN_ID ABA58938.1 GB:DB_XREF GI:76884257 InterPro:IPR002052 InterPro:IPR002744 LENGTH 183 SQ:AASEQ MNMYNREPIVLNRDCEAVLVPMADKVIIPKDTEVVIAQDLGGSYTVYVSGNLARIEGKDADALGLEPVAPPELPENASEEDLEKLAWEQMKTCFDPEIPINIVDLGLVYECSISSLPEGQKEVDIKMTLTAPGCGMGEVLVQDVKEKVEAIPAIGVANVELVFDPPWNYSMMSEAAKIQTGMY GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 79->182|YITW_BACSU|2e-13|35.0|100/102| PROS 161->167|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 90->182|1uwdA|3e-13|34.8|89/102| RP:PDB:NREP 1 RP:PDB:REP 81->181|3cq2B|9e-24|32.6|95/97| RP:PFM:NREP 1 RP:PFM:REP 88->161|PF01883|6e-11|42.9|70/76|DUF59| HM:PFM:NREP 1 HM:PFM:REP 86->160|PF01883|3e-21|43.7|71/76|DUF59| RP:SCP:NREP 1 RP:SCP:REP 78->182|1uwdA|1e-21|31.7|101/102|d.52.8.2| HM:SCP:REP 77->182|1uwdA_|1.1e-24|37.3|102/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 429 OP:NHOMOORG 371 OP:PATTERN ----111211111112-1------1-------------------1-----11--11111111111-11 -11--111111111--------------------------1-1---------------------------------------2-1-11111111111-111111111211--------------------------11111---11--------------------1----------------11112---1-1---------------111111---12211--111111--1111111111111111111112--11-213333221111-12-11111111111111111111111111111111111111112221111----------------------------2------------------1----1111111111111222111-11122222222222-1111111111111111111111222211111111111111111111111111-11-----------------------------111111------------2222----122222-----1---------11--2--------1-------------1-1------------------------22121---1-1-----------------1--21-----111-1--1---------------------1211----------------------------------------------------------------------------------------------11111111111111--------------------------1-----------------111111111---------------11111111111111------1111------------------------------------1111111111121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 56.8 SQ:SECSTR #############################################################################ccccHHHHHHHHHTTcEETTTTEETTTTTcEEEEEEET#TcTETTEEEEEcccccccccccHHHHHHHHHHHTcTTccEEEEEEcccccccGGGccHHHHHHHTc# DISOP:02AL 1-4, 66-80| PSIPRED ccccccccEEEEccccEEEEccccEEEEccccEEEEEEEcccEEEEEEEcEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEccEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEEEEccccHHHccHHHHHHHccc //