[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58946.1
DDBJ      :             2-phosphoglycolate phosphatase
Swiss-Prot:GPH_NITOC    RecName: Full=Phosphoglycolate phosphatase;         Short=PGPase;         Short=PGP;         EC=3.1.3.18;

Homologs  Archaea  21/68 : Bacteria  684/915 : Eukaryota  22/199 : Viruses  1/175   --->[See Alignment]
c.108.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->217 2hszA PDBj 2e-39 40.1 %
:RPS:PDB   4->217 3d6jA PDBj 3e-32 24.4 %
:RPS:SCOP  8->221 2hszA1  c.108.1.6 * 2e-55 39.3 %
:HMM:SCOP  2->222 2hszA1 c.108.1.6 * 1.1e-53 34.4 %
:RPS:PFM   6->186 PF00702 * Hydrolase 4e-15 32.6 %
:HMM:PFM   8->186 PF00702 * Hydrolase 1.2e-25 22.6 177/192  
:BLT:SWISS 1->225 GPH_NITOC e-129 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58946.1 GT:GENE ABA58946.1 GT:PRODUCT 2-phosphoglycolate phosphatase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2838863..2839540 GB:FROM 2838863 GB:TO 2839540 GB:DIRECTION + GB:PRODUCT 2-phosphoglycolate phosphatase GB:PROTEIN_ID ABA58946.1 GB:DB_XREF GI:76884265 InterPro:IPR005833 InterPro:IPR005834 InterPro:IPR006346 InterPro:IPR006402 InterPro:IPR006439 LENGTH 225 SQ:AASEQ MLKQPEMILIDVDGTLVDSVPDLTFCTDTMMERLGLPLRGETKVRQWVGNGVERLIKRALVDNMEGEPEEDLYQKAETIFLALYADNTSKRSHLYPGVNEGLAWLKSQGYRVGCVTNKAAQFTYPLLTELGIIDYFEIVISGDTLPEKKPHPAPLLHAASHFGIAPEKALMIGDSISDVKAARAANFQIVCLSYGYNHGVDIRDSQPDSVIDSLIEIKNLLSQAA GT:EXON 1|1-225:0| SW:ID GPH_NITOC SW:DE RecName: Full=Phosphoglycolate phosphatase; Short=PGPase; Short=PGP; EC=3.1.3.18; SW:GN OrderedLocusNames=Noc_2493; SW:KW Carbohydrate metabolism; Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->225|GPH_NITOC|e-129|100.0|225/225| GO:SWS:NREP 2 GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 4->217|2hszA|2e-39|40.1|212/222| RP:PDB:NREP 1 RP:PDB:REP 4->217|3d6jA|3e-32|24.4|205/206| RP:PFM:NREP 1 RP:PFM:REP 6->186|PF00702|4e-15|32.6|181/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 8->186|PF00702|1.2e-25|22.6|177/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 8->221|2hszA1|2e-55|39.3|214/224|c.108.1.6| HM:SCP:REP 2->222|2hszA1|1.1e-53|34.4|221/0|c.108.1.6|1/1|HAD-like| OP:NHOMO 1350 OP:NHOMOORG 728 OP:PATTERN --1-1-------------1-1----------------------1-311-1222121223211------ 112-1-1111111--1111-11---211111--222-111-222----2--1-11--1--------2--111111-111123111111221211-----2131-2--1-----------------22132212212111--1111--1--22--------------12211--------------------1221111112412111112111111211-1121311111121-22212212222222-11--2-11--1-1--22----11-1--1--11111112231111111111111111111111112112221111-1-341111111-1-11---1112-11212121--111-2-1-113---111-21111----324241111112133333333333-22322324121-3222122111212222233242443331111111111111132---------1-------------------12121133333233432222221134333333215435412334443332324233333223223322222222222111-211-1-311-12222221322222321121111111111---------2123322534242222224444444344444334443--12223------32131222222222222-222223222222222222322223232222222222222222232222222--322222212222---22222211111233233311111111222134444442223233334334433333444111111111311131111121111333222233311112121--11--111111111-2--------------------------12--1-111--2 -----------2----1-1-1-1---1-------11-----------------1--------------------------------------1---------------2-------------------------------------------------------------------1--8---1121-81211------ --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 100.0 SQ:SECSTR cTccccEEEEcccTTTEEcHHHHHHHHHHHHHHTTcccccHHHHHTTTTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHGGHHHHTTGcEEcTTHHHHHHHHHHHTcEEEEEcccccHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEETTccccTTGGGGccccEEEccGGGGHHHHTcHH DISOP:02AL 1-2| PSIPRED ccccccEEEEEccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccccccEEEEcHHcccccccHHHHHHHHHHHcccHHHEEEEcccHHHHHHHHHcccEEEEEEccccccccHHHccccEEEccHHHHHHHHHHHc //