[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58951.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58951.1 GT:GENE ABA58951.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2843668..2844105) GB:FROM 2843668 GB:TO 2844105 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58951.1 GB:DB_XREF GI:76884270 LENGTH 145 SQ:AASEQ MNETQARLEQRHPITIFLSIFLAIASGIALIGYLFTITGAKRLSLEQQLLIDTLAWPEVGLTLLINATIFIAALALYLHRRLALYFFLAAIVADLGRLLLIAFKKGSLAAVFSAGIGGEGLLLVLVILLGTCAYTWRLYRAGILD GT:EXON 1|1-145:0| TM:NTM 4 TM:REGION 19->40| TM:REGION 57->79| TM:REGION 82->103| TM:REGION 111->133| SEG 72->90|aalalylhrrlalyfflaa| SEG 115->130|giggeglllvlvillg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccc //