[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58968.1
DDBJ      :             Phage SPO1 DNA polymerase-related protein
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  407/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.18.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->222 1ui0A PDBj 1e-41 49.4 %
:RPS:PDB   63->224 2d07A PDBj 3e-38 14.9 %
:RPS:SCOP  44->230 1l9gA  c.18.1.2 * 7e-43 38.2 %
:HMM:SCOP  43->231 1l9gA_ c.18.1.2 * 4.7e-60 46.3 %
:RPS:PFM   81->176 PF03167 * UDG 3e-13 39.6 %
:HMM:PFM   74->222 PF03167 * UDG 2.1e-44 41.3 143/150  
:HMM:PFM   1->24 PF03603 * DNA_III_psi 3.9e-05 33.3 24/128  
:BLT:SWISS 75->223 DPOL_BPSP1 2e-08 27.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58968.1 GT:GENE ABA58968.1 GT:PRODUCT Phage SPO1 DNA polymerase-related protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2863266..2863961) GB:FROM 2863266 GB:TO 2863961 GB:DIRECTION - GB:PRODUCT Phage SPO1 DNA polymerase-related protein GB:PROTEIN_ID ABA58968.1 GB:DB_XREF GI:76884287 InterPro:IPR005122 InterPro:IPR005273 LENGTH 231 SQ:AASEQ MDSRQLHYLETMGIQVWQQRQPTSTGKKPLVETGEELIPLAPSAEVASEWEELAVQVASCTACLLHCGRTQTVFGVGDQAAKWLIVGEAPGVEEDRQGEPFVGRAGQLLNAMLEAVGLQRGQVYIANILKCRPPNNRDPLPEEVAHCEPYLRRQVALLRPRIILAVGRVAGQNLLKSSLPLGRLRGSVHQYPETTIPLVVTYHPAYLLRAPREKRRAWQDLQLAHKVYREF GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 75->223|DPOL_BPSP1|2e-08|27.6|145/924| BL:PDB:NREP 1 BL:PDB:REP 51->222|1ui0A|1e-41|49.4|170/192| RP:PDB:NREP 1 RP:PDB:REP 63->224|2d07A|3e-38|14.9|161/215| RP:PFM:NREP 1 RP:PFM:REP 81->176|PF03167|3e-13|39.6|96/147|UDG| HM:PFM:NREP 2 HM:PFM:REP 74->222|PF03167|2.1e-44|41.3|143/150|UDG| HM:PFM:REP 1->24|PF03603|3.9e-05|33.3|24/128|DNA_III_psi| RP:SCP:NREP 1 RP:SCP:REP 44->230|1l9gA|7e-43|38.2|186/191|c.18.1.2| HM:SCP:REP 43->231|1l9gA_|4.7e-60|46.3|188/191|c.18.1.2|1/1|Uracil-DNA glycosylase-like| OP:NHOMO 646 OP:NHOMOORG 459 OP:PATTERN 11111121111111121121122131121222--------------1-11111-111111121-1111 23311----------11--------1-----113131-11311-1-----------------1--1--1---------1111311111--------------------1----------------11-1111111111122111121-11---1111111111--111111111111111111-1111111---1111111111111111-----111-----------------------------------11------111--11-------------------------------------------------------1--2-2222222-2-3-222----22--2---2111111111111111-1112122311111323322222132211111111112-222221223221122233234322312221222222211222222222223212211111111111111111111111111111211122111122221222111122332222111232221--111111--11112-11121-111-------112221-11111----------1-1111213343321211111---------------1111121---------------------------------2211--------------------------------------------------------------------------------------------------11112------------------------------------------------------------------------1-12122111------11--1111--------11--------------------------1111111111232 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 81.0 SQ:SECSTR #####################################ccccccccccHHHHHHHHHTTTTcGccccccccEEccccccTTccEEEEEccccHHHHHHTcccccccccHHHHHHHHTTcccccccGGGGGGHHHEEcccccHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHTcccccccccEEEEEcccEEEEEccccTTccccGGTHHHHHHHHHH####### DISOP:02AL 1-3, 18-43| PSIPRED ccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccEEccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHcccccccEEccEEEEEccccEEEEEEEcHHHHHcccHHHHHHHHHHHHHHHHHHcc //