[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58973.1
DDBJ      :             acetolactate synthase, large subunit
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  765/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
c.31.1c.36.1c.92.2
:582 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->576 1n0hA PDBj e-137 47.0 %
:RPS:PDB   5->546 1bfdA PDBj e-135 24.3 %
:RPS:SCOP  4->525 1fp4B  c.92.2.3 * 2e-90 10.5 %
:HMM:SCOP  3->187 1ybhA2 c.36.1.5 * 2.2e-64 50.0 %
:HMM:SCOP  188->364 1jscA1 c.31.1.3 * 1.9e-70 56.1 %
:HMM:SCOP  371->570 2djiA3 c.36.1.9 * 2.6e-67 44.9 %
:RPS:PFM   4->173 PF02776 * TPP_enzyme_N 2e-49 51.8 %
:RPS:PFM   197->330 PF00205 * TPP_enzyme_M 2e-34 49.3 %
:RPS:PFM   310->366 PF09334 * tRNA-synt_1g 7e-04 31.6 %
:RPS:PFM   411->534 PF02775 * TPP_enzyme_C 2e-30 50.0 %
:HMM:PFM   5->171 PF02776 * TPP_enzyme_N 2.4e-64 51.5 167/172  
:HMM:PFM   395->543 PF02775 * TPP_enzyme_C 9.2e-51 42.9 147/150  
:HMM:PFM   197->331 PF00205 * TPP_enzyme_M 1.9e-45 45.2 135/137  
:BLT:SWISS 1->568 ILVI_HAEIN 0.0 56.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58973.1 GT:GENE ABA58973.1 GT:PRODUCT acetolactate synthase, large subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2868358..2870106) GB:FROM 2868358 GB:TO 2870106 GB:DIRECTION - GB:PRODUCT acetolactate synthase, large subunit GB:PROTEIN_ID ABA58973.1 GB:DB_XREF GI:76884292 InterPro:IPR004407 InterPro:IPR011766 InterPro:IPR012000 InterPro:IPR012001 LENGTH 582 SQ:AASEQ MGLLSGAEILVRCLQDEGVEYIFGYPGGAVLHIYDALYQQEAVKHILVRHEQGAAHGADGYARATGKPGVVLVTSGPGATNAVTGIATAYMDSIPMVVITGQVPRAAIGSDAFQEVDSVGITRPCVKHNFLVKDLNDLALTVRKAFYIATTGRPGPVVVDIPKDVTDPNVKIPYHYPEQLTLRSYHHPVTVETPEQIKKAVDLILSARRPMIYAGGGVVLGNAAQPLTEFVRLLGYPVTNTLMGLGGYPGTDPQFVGMLGMHGTYEANMGMHECDVLIAIGARFDDRVTGNLEQFCPYAKIIHVDIDPSSISKNVQVDIPIVGDVGLVLKEMITVLKSTDKRPDGEALDKWWSQIEEWRGRRCLRYQQDGKLIKPQYIIERLYEITKGEAYVTSDVGQHQMWTAQFYKFDKPRRWINSGGLGTMGFGLPAAMGVQLAYLDAPVVCVTGEASIQMCIQELSTCMQYALPIKIVNLNNRYMGMVRQWQEFFYDRRYSHSYMDALPDFVKLAEAYGHVGMQIEEPGDVDAALKEAFALKDRLVFLDFITDQTENVYPMIAQGKGHHEMHLAPECKVPQSLEREWA GT:EXON 1|1-582:0| BL:SWS:NREP 1 BL:SWS:REP 1->568|ILVI_HAEIN|0.0|56.5|566/573| BL:PDB:NREP 1 BL:PDB:REP 4->576|1n0hA|e-137|47.0|562/599| RP:PDB:NREP 1 RP:PDB:REP 5->546|1bfdA|e-135|24.3|518/523| RP:PFM:NREP 4 RP:PFM:REP 4->173|PF02776|2e-49|51.8|170/170|TPP_enzyme_N| RP:PFM:REP 197->330|PF00205|2e-34|49.3|134/138|TPP_enzyme_M| RP:PFM:REP 310->366|PF09334|7e-04|31.6|57/363|tRNA-synt_1g| RP:PFM:REP 411->534|PF02775|2e-30|50.0|124/139|TPP_enzyme_C| HM:PFM:NREP 3 HM:PFM:REP 5->171|PF02776|2.4e-64|51.5|167/172|TPP_enzyme_N| HM:PFM:REP 395->543|PF02775|9.2e-51|42.9|147/150|TPP_enzyme_C| HM:PFM:REP 197->331|PF00205|1.9e-45|45.2|135/137|TPP_enzyme_M| GO:PFM:NREP 11 GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02776|IPR012001| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00205|IPR012000| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF00205|IPR012000| GO:PFM GO:0000166|"GO:nucleotide binding"|PF09334|IPR015413| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF09334|IPR015413| GO:PFM GO:0005524|"GO:ATP binding"|PF09334|IPR015413| GO:PFM GO:0005737|"GO:cytoplasm"|PF09334|IPR015413| GO:PFM GO:0006412|"GO:translation"|PF09334|IPR015413| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF09334|IPR015413| GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 4->525|1fp4B|2e-90|10.5|494/522|c.92.2.3| HM:SCP:REP 3->187|1ybhA2|2.2e-64|50.0|182/0|c.36.1.5|1/2|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 188->364|1jscA1|1.9e-70|56.1|171/0|c.31.1.3|1/1|DHS-like NAD/FAD-binding domain| HM:SCP:REP 371->570|2djiA3|2.6e-67|44.9|198/0|c.36.1.9|2/2|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 3429 OP:NHOMOORG 1003 OP:PATTERN 11-1--6765566674-31221143--21123243222222221312213453111-----2421-11 4372942222224257955-54336E545555455555EG2225333-232196754311535255B98621222111-211911111223112--111-1111142211---------------21122111111222331111932523432211113111222333821111111211111211111-134555554571465536234434545235342-5555542544444444444444434444122145112-27622553331344231111---22222222222222-------------221222111122135-------5-42133111-112--2122165222121221112--1-113332-11-124DAB2249448533333332316-66955B49872-644346B775896414168A42367685555555542212332-----------------------------3335226DA8888A99886666AADE99995899I89A924654333228355B73333111311111111112522-A22312334333412213112433323353621111111111-1-------1111211322241312222332422322223323233-1-311111111155554555666576766-6646767656666665664989763347566556667667664965666651-75555554555511---1---223332762222222-22213222333332312442A99949464588633333----1---313253333322222332222222211111111331132------------------------111--1-------11--1-111222 ----22--21----26443345396774443534342535355355321233652223111133242521572325633652222233-31142221111112423-25-4232222--1212124262AK2-42411122225212112211421123374163211122235111118121236127354223111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 582 STR:RPRED 100.0 SQ:SECSTR TccEcHHHHHHHHHHHTTccEEEEcccGGGHHHHTTccTTTccEEEEcccHHHHHHHHHHHHHHHTccEEEEEEHHHHHHHTHHHHHHHHHHTccEEEEEEEccHHHHTTTcTccTTGGGTTTTcccEEEccccGGGHHHHHHHHHHHHHccccccEEEEEEGGGTTccccGGGGGGcccHTTccccccccccHHHHHHHHHHHHHccccEEEEcHHHHHHTcHHHHHHHHHHHTccEEccccccccccTTcTTEEEEcccGcHHHHHHHHTTccEEEEEcccTTcccccccccccTTcEEEEEEccHHHHHHccccEEEEEccHHHHHHHHHHHcHTTccccccHHHHcccccccccccccccccccccccccHHHHHHHHHHHccTTcEEEEEcGGGHHHHHHHcccccTTcEEEcTTccccccHHHHHHHHHHHcTTccEEEEEEHHHHTTTGGGHHHHHHHTcccEEEEEEccccHHHHHHHHHTTccccccccccccccHHHHHHHTTcEEEEEccHHHHHHHHHHHHHGccccEEEEEEcccccccTTTTcTTccGGGcccccccccccHHHHTHH DISOP:02AL 1-3, 570-582| PSIPRED ccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEcHHcccccccccccccccccccccHHHHHHHHcccEEEEEccccccccccccHHcccccEEEEEEEcHHHHcccccccEEEEEcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEcccHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHccHHHHHHHHHccccEEEEEEEcccccEEEHHHHHccccccccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccHHHHccccccccccccccccc //