[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58982.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58982.1 GT:GENE ABA58982.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2881210..2881569) GB:FROM 2881210 GB:TO 2881569 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58982.1 GB:DB_XREF GI:76884301 LENGTH 119 SQ:AASEQ MTRSIGTMALLALLLLGFTSSALAGEGYGSEVGEKLGRGLANVATGWVEIPKNIINTSKDSNVGIGVSWGLLKGIGQTLGRTLVGVGELATFFVPTAKIIHPTYVFEDFYRDTTYGTGH GT:EXON 1|1-119:0| TM:NTM 1 TM:REGION 2->24| SEG 9->25|allallllgftssalag| OP:NHOMO 13 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------221------------------111-111----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 117-119| PSIPRED cccHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEHHHHHHHHHHHHHHHHHHHHHEEEccccccccccHHHHHccccccccccc //