[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58995.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
a.35.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   102->157 3g5gN PDBj 1e-06 38.9 %
:RPS:PDB   102->165 3clcA PDBj 1e-10 31.2 %
:RPS:SCOP  102->161 2auwA1  a.35.1.10 * 7e-11 10.0 %
:HMM:SCOP  102->163 2b5aA1 a.35.1.3 * 6.4e-13 33.9 %
:RPS:PFM   102->156 PF01381 * HTH_3 6e-06 43.6 %
:HMM:PFM   106->156 PF01381 * HTH_3 6.5e-14 45.1 51/55  
:HMM:PFM   44->77 PF02604 * PhdYeFM 0.00026 26.5 34/75  
:HMM:PFM   65->100 PF00781 * DAGK_cat 0.00042 33.3 36/129  
:BLT:SWISS 99->163 Y272_METJA 1e-06 33.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58995.1 GT:GENE ABA58995.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2891872..2892369) GB:FROM 2891872 GB:TO 2892369 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XRE family GB:PROTEIN_ID ABA58995.1 GB:DB_XREF GI:76884314 InterPro:IPR001387 LENGTH 165 SQ:AASEQ MTAKGRLRNANCSKASAAVGNSQARLSRKLQDPMQSDLDIKPLIKRGDKPEWAVLPYEEYLALKEKAEMLEDVAAFDQAMVVGGEAMPHEVVKRLVEGENPIKVWRIYRGLTQHNLAEQAELSQSYLAMIEKGEREGTVKALKQIAKVLGVDIDDLVDTRDQDVV GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 99->163|Y272_METJA|1e-06|33.8|65/66| BL:PDB:NREP 1 BL:PDB:REP 102->157|3g5gN|1e-06|38.9|54/75| RP:PDB:NREP 1 RP:PDB:REP 102->165|3clcA|1e-10|31.2|64/76| RP:PFM:NREP 1 RP:PFM:REP 102->156|PF01381|6e-06|43.6|55/55|HTH_3| HM:PFM:NREP 3 HM:PFM:REP 106->156|PF01381|6.5e-14|45.1|51/55|HTH_3| HM:PFM:REP 44->77|PF02604|0.00026|26.5|34/75|PhdYeFM| HM:PFM:REP 65->100|PF00781|0.00042|33.3|36/129|DAGK_cat| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 102->161|2auwA1|7e-11|10.0|60/67|a.35.1.10| HM:SCP:REP 102->163|2b5aA1|6.4e-13|33.9|62/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1------11---1----1---11--1----------1---------------------------------111--1----------------1----------1---------1-----------------------------1-----------------------------------1-----1---------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------- STR:NPRED 79 STR:RPRED 47.9 SQ:SECSTR ######################################################################################ccccHHHHHHHHHcHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHHHHHT DISOP:02AL 1-9, 14-29, 79-80| PSIPRED cccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHccHHcccccHHcccccccccHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccc //