[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58999.1
DDBJ      :             Protein of unknown function DUF820
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->184 1wdjA PDBj 1e-09 30.6 %
:RPS:SCOP  17->188 1wdjA  c.52.1.27 * 1e-25 27.1 %
:HMM:SCOP  2->188 1wdjA_ c.52.1.27 * 3.5e-43 39.2 %
:RPS:PFM   55->152 PF05685 * DUF820 4e-14 38.5 %
:HMM:PFM   44->152 PF05685 * DUF820 4.3e-24 39.3 107/111  
:BLT:SWISS 11->188 Y925_SYNY3 9e-07 24.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58999.1 GT:GENE ABA58999.1 GT:PRODUCT Protein of unknown function DUF820 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2894664..2895230) GB:FROM 2894664 GB:TO 2895230 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF820 GB:PROTEIN_ID ABA58999.1 GB:DB_XREF GI:76884318 InterPro:IPR008538 LENGTH 188 SQ:AASEQ MGLGADSRIKFRYEDYKSLPESEIRRYELLDGELVMVPSPSEYHQRLSRNLGFLLWEYVQERDLGQIYSAPLDVVLGQGSGREIVQPDIFFIAKARASMIAETEIRGAPDLIVEILSPATARRDRTYKSTLYARYGVKEYWLVDPESRVIELLTLGPRGFERVACYGEREVLRSPLLPGLRLALTEVF GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 11->188|Y925_SYNY3|9e-07|24.9|173/202| BL:PDB:NREP 1 BL:PDB:REP 31->184|1wdjA|1e-09|30.6|147/186| RP:PFM:NREP 1 RP:PFM:REP 55->152|PF05685|4e-14|38.5|96/112|DUF820| HM:PFM:NREP 1 HM:PFM:REP 44->152|PF05685|4.3e-24|39.3|107/111|DUF820| RP:SCP:NREP 1 RP:SCP:REP 17->188|1wdjA|1e-25|27.1|166/186|c.52.1.27| HM:SCP:REP 2->188|1wdjA_|3.5e-43|39.2|181/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 198 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1-11--------------------3----------------1----------------1------3-------------------------------HD----1225244535--------11-5353-----------------1----4-------------------------48-------------------------------------------------------------------------------------------------------5----------------11----------2---A99-45--3243-6---1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2----------------------------------------1-1----25-------------------------3------------------------------------1--1------------------------------------------------------------------------------------------------------3---------------1----------------------------------------------------------------------------11--------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 78.7 SQ:SECSTR ##############################TccEEEEEccHHHHHHHHHHHHHHHHHHHHHHccEEEEcTTccEEcTTcc###EEcccEEEEEHHHHHTccHHHHHccccEEEEEccTTccHHHHHHHHHHHHHTTccEEEEEETTTTEEEEEcTTc###ccEEEEcccEEEcTTTcTTcEEEc#### DISOP:02AL 1-6| PSIPRED ccccccccccccHHHHHHHHccccccEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEcccccEEEEEEEEEEEccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccEEEEEEEccccEEEEEEEccccEEEEccccccEEEHHHcc //