[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59010.1
DDBJ      :             NADH-quinone oxidoreductase, chain I
Swiss-Prot:NUOI2_NITOC  RecName: Full=NADH-quinone oxidoreductase subunit I 2;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit I 2;AltName: Full=NDH-1 subunit I 2;

Homologs  Archaea  40/68 : Bacteria  569/915 : Eukaryota  159/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->141 2fug9 PDBj 1e-21 45.1 %
:RPS:PDB   30->141 1d0cB PDBj 5e-16 9.1 %
:RPS:SCOP  36->142 2fug91  d.58.1.5 * 6e-17 39.3 %
:HMM:SCOP  36->145 2fug91 d.58.1.5 * 1.7e-29 31.8 %
:HMM:PFM   60->79 PF00037 * Fer4 2.7e-08 55.0 20/24  
:HMM:PFM   96->117 PF00037 * Fer4 1.5e-09 59.1 22/24  
:BLT:SWISS 1->162 NUOI2_NITOC 1e-76 100.0 %
:PROS 63->74|PS00198|4FE4S_FER_1
:PROS 102->113|PS00198|4FE4S_FER_1
:REPEAT 2|46->78|85->117
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59010.1 GT:GENE ABA59010.1 GT:PRODUCT NADH-quinone oxidoreductase, chain I GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2908183..2908671) GB:FROM 2908183 GB:TO 2908671 GB:DIRECTION - GB:PRODUCT NADH-quinone oxidoreductase, chain I GB:PROTEIN_ID ABA59010.1 GB:DB_XREF GI:76884329 InterPro:IPR001450 InterPro:IPR010226 LENGTH 162 SQ:AASEQ MNTLRSYIKSFLLWELLLGLKLTGRYLFTKKVTVQFPEERTPQSPRFRGLHALRRYPNGEERCIACKLCEAVCPALAITIDSEQREDGTRRTTRYDIDLFKCIYCGFCEESCPVDSIVETRILDYHFEERGEHILHKEQLLALGDKYEAQIAADRAADAPYR GT:EXON 1|1-162:0| SW:ID NUOI2_NITOC SW:DE RecName: Full=NADH-quinone oxidoreductase subunit I 2; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit I 2;AltName: Full=NDH-1 subunit I 2; SW:GN Name=nuoI2; OrderedLocusNames=Noc_2557; SW:KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Iron;Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone;Repeat; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->162|NUOI2_NITOC|1e-76|100.0|162/162| GO:SWS:NREP 9 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| PROS 63->74|PS00198|4FE4S_FER_1|PDOC00176| PROS 102->113|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|46->78|85->117| SEG 12->27|llwelllglkltgryl| SEG 149->159|aqiaadraada| BL:PDB:NREP 1 BL:PDB:REP 36->141|2fug9|1e-21|45.1|102/154| RP:PDB:NREP 1 RP:PDB:REP 30->141|1d0cB|5e-16|9.1|110/414| HM:PFM:NREP 2 HM:PFM:REP 60->79|PF00037|2.7e-08|55.0|20/24|Fer4| HM:PFM:REP 96->117|PF00037|1.5e-09|59.1|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 36->142|2fug91|6e-17|39.3|107/154|d.58.1.5| HM:SCP:REP 36->145|2fug91|1.7e-29|31.8|110/0|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 887 OP:NHOMOORG 768 OP:PATTERN --1--111111111111--1111-111112111-11-------------11-12111111--11---- 22212---------11211-11--11111111111111111111-1--1-----------22111112221-----------1222221111----1--1-11--21211--------------1-111----12-211111111111111111111111111111111-111111111111111111----1-111111111111111------1-1111----------11----------------------------------------------------------------------------------------------1-----------------------2--1-1111----12-------22-111111111111111112322211111111111-11111111111111112221112211111111222211111111111222-11111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---11-----222122213222212-21111111111111111111111-1111111---------------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111211111111-21111111111111111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111111-111111------------------------------------1---------121 ----111-----111111111111111111111111111111111111111111-1111111111----1--111------11111---12111111111111112-14-215232-111-111111112B1-313111-31112111--1--111111--11111111-1111-1111I11-1122241211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 71.0 SQ:SECSTR ###########################HHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHTGTTccEEEEccccccHHHHHHHHHHHHHHHHHHGGGccccEEEEcccccTTccccEEccccccH#################### DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccccccHHHHHcccccEEEEccccccccccccEEEEcccccccccccHHHcccccEEEEEccccccccHHHHcccHHHHHHccccHHHHHHHHHHcccccc //