[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59014.1
DDBJ      :             NADH dehydrogenase (ubiquinone),  24 kDa subunit
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  538/915 : Eukaryota  172/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->143 3iam2 PDBj 1e-22 40.9 %
:RPS:PDB   90->172 2auvA PDBj 4e-19 28.9 %
:RPS:SCOP  20->175 2fug21  c.47.1.21 * 8e-32 32.3 %
:HMM:SCOP  20->175 2fug21 c.47.1.21 * 1.8e-54 47.7 %
:RPS:PFM   32->172 PF01257 * Complex1_24kDa 1e-34 50.0 %
:HMM:PFM   29->175 PF01257 * Complex1_24kDa 1.1e-58 52.1 144/145  
:BLT:SWISS 32->172 NUOE_RICFE 2e-31 43.3 %
:PROS 132->150|PS01099|COMPLEX1_24K
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59014.1 GT:GENE ABA59014.1 GT:PRODUCT NADH dehydrogenase (ubiquinone), 24 kDa subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2913403..2913930) GB:FROM 2913403 GB:TO 2913930 GB:DIRECTION - GB:PRODUCT NADH dehydrogenase (ubiquinone), 24 kDa subunit GB:PROTEIN_ID ABA59014.1 GB:DB_XREF GI:76884333 InterPro:IPR002023 LENGTH 175 SQ:AASEQ MSVGQPERRKSRNREEENLLSSEVRQQIDYWIAKYPPERKQSAVIPALHIVQAVNGGYLTDKLLDAVAEYLEMRPISVYEVATFYSMYELKPIGRHKISVCTNISCQLSGSDEVVAHLQKRLGIGFGETTPDHRFTVKEAECLGACGGAPMMMAGHTYHENLTSEKIDQILEALK GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 32->172|NUOE_RICFE|2e-31|43.3|141/167| PROS 132->150|PS01099|COMPLEX1_24K|PDOC00843| SEG 7->18|errksrnreeen| SEG 144->155|gacggapmmmag| BL:PDB:NREP 1 BL:PDB:REP 33->143|3iam2|1e-22|40.9|110/179| RP:PDB:NREP 1 RP:PDB:REP 90->172|2auvA|4e-19|28.9|83/85| RP:PFM:NREP 1 RP:PFM:REP 32->172|PF01257|1e-34|50.0|138/142|Complex1_24kDa| HM:PFM:NREP 1 HM:PFM:REP 29->175|PF01257|1.1e-58|52.1|144/145|Complex1_24kDa| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01257|IPR002023| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01257|IPR002023| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01257|IPR002023| RP:SCP:NREP 1 RP:SCP:REP 20->175|2fug21|8e-32|32.3|155/178|c.47.1.21| HM:SCP:REP 20->175|2fug21|1.8e-54|47.7|155/0|c.47.1.21|1/1|Thioredoxin-like| OP:NHOMO 930 OP:NHOMOORG 716 OP:PATTERN -----------------------------1----1---------1--1----------1-1------- 11211---------11111-11--12111111111111111111-1--1-----------11111111111----------1-11112--1--1-----1-11--21111--------------1-----1---1-222224441-1111111--11------11--11--------------11111331--------------------------------------------------------------1---------------------------------------------------------------------124-1111111111121------2-2112--22113436331211121--3--111111111221111112222211111111111-11211212121122213332223322111122333311111111111322-21111111111111111111111111111111111111-22212111111111111111111111111223311111221111111212211222111111111112111131-2-1--3-----343243264111111641--1---------------------11112---2-----------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1-1111111111111112--11---------------11111111111-1111111111111-1111111111111--------------11111111111111111-111111------------------------------------3223333233221 ----111-211-111111111111111111111111111111111111111111111111-1111----1--111------11111---12111111111111112-111211111111111111113-3B1-3121-111113111-111111111111111111121251111111171111121321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 79.4 SQ:SECSTR ################################TTccTTcGGGGHHHHHHHHHHHHc#cccHHHHHHHHHHHTccHHHHHHHHTTcccccccccccccEEccccHHHHTTTHHHHHHHHHHHHccccccccccccccccccccccccTTccccEEGGGccccccccHHHHHHH### DISOP:02AL 1-19| PSIPRED cccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccEEEEccEEEEcccHHHHHHHHHHcc //