[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59023.1
DDBJ      :             Ribosomal RNA methyltransferase RrmJ/FtsJ
Swiss-Prot:RRMJ_NITOC   RecName: Full=Ribosomal RNA large subunit methyltransferase J;         EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase;

Homologs  Archaea  35/68 : Bacteria  450/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->202 1eizA PDBj 3e-52 56.0 %
:RPS:PDB   28->202 1eizA PDBj 3e-17 56.0 %
:RPS:SCOP  28->203 1eizA  c.66.1.2 * 8e-60 55.7 %
:HMM:SCOP  28->207 1ej0A_ c.66.1.2 * 8.3e-46 39.4 %
:RPS:PFM   31->201 PF01728 * FtsJ 2e-26 39.2 %
:HMM:PFM   29->204 PF01728 * FtsJ 3.2e-56 43.2 176/181  
:BLT:SWISS 1->212 RRMJ_NITOC e-121 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59023.1 GT:GENE ABA59023.1 GT:PRODUCT Ribosomal RNA methyltransferase RrmJ/FtsJ GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2922551..2923189) GB:FROM 2922551 GB:TO 2923189 GB:DIRECTION - GB:PRODUCT Ribosomal RNA methyltransferase RrmJ/FtsJ GB:PROTEIN_ID ABA59023.1 GB:DB_XREF GI:76884342 InterPro:IPR002877 LENGTH 212 SQ:AASEQ MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAERVGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIYLGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKDNGGG GT:EXON 1|1-212:0| SW:ID RRMJ_NITOC SW:DE RecName: Full=Ribosomal RNA large subunit methyltransferase J; EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase; SW:GN Name=rrmJ; Synonyms=ftsJ; OrderedLocusNames=Noc_2570; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->212|RRMJ_NITOC|e-121|100.0|212/212| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 28->202|1eizA|3e-52|56.0|175/180| RP:PDB:NREP 1 RP:PDB:REP 28->202|1eizA|3e-17|56.0|175/180| RP:PFM:NREP 1 RP:PFM:REP 31->201|PF01728|2e-26|39.2|171/179|FtsJ| HM:PFM:NREP 1 HM:PFM:REP 29->204|PF01728|3.2e-56|43.2|176/181|FtsJ| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 1 RP:SCP:REP 28->203|1eizA|8e-60|55.7|176/181|c.66.1.2| HM:SCP:REP 28->207|1ej0A_|8.3e-46|39.4|180/0|c.66.1.2|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1092 OP:NHOMOORG 682 OP:PATTERN -----------------------111111111111111111111111111111--------111--11 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111-11111111111111111111111111-1111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------111111-1-------------------------111111111111111111111111111111111-11111111--111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1111111111--------------------------------------- 2212332172322333333323333323323223221423244322223232312133333333333333233333333333333334-2323122323332233223435353341322322354252AL5-4561222423712222332232513324235331433A35342322G2323332332352344445 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 97.6 SQ:SECSTR ccccHHHccTTcHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHccccTTcEEEEEccTTcHHHHHHHHHHcTTcEEEEEEcccccccTTEEEEEccTTcHHHHHHHHHHHTTccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccTTHHHHHHHHHHHEEEEEEEccTTccTTccEEEEEEEEEEc##### DISOP:02AL 1-13, 209-212| PSIPRED cccccHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHccccEEEEEEcccccccccEEEEEEccccHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHccEEEEEEcccccccccEEEEEEEccccccccc //