[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59024.1
DDBJ      :             transcription elongation factor GreA
Swiss-Prot:GREA_NITOC   RecName: Full=Transcription elongation factor greA;AltName: Full=Transcript cleavage factor greA;

Homologs  Archaea  0/68 : Bacteria  846/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.2.1d.26.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->132 1grjA PDBj 1e-40 57.4 %
:RPS:PDB   26->158 3bmbA PDBj 2e-32 24.2 %
:RPS:SCOP  3->79 1grjA1  a.2.1.1 * 1e-24 66.2 %
:RPS:SCOP  83->155 2etnA2  d.26.1.2 * 8e-20 37.0 %
:HMM:SCOP  2->79 1grjA1 a.2.1.1 * 5.4e-29 61.5 %
:HMM:SCOP  80->158 1grjA2 d.26.1.2 * 6.7e-24 41.8 %
:RPS:PFM   6->74 PF03449 * GreA_GreB_N 7e-18 65.2 %
:RPS:PFM   86->152 PF01272 * GreA_GreB 7e-10 49.3 %
:HMM:PFM   2->74 PF03449 * GreA_GreB_N 3.8e-34 56.9 72/74  
:HMM:PFM   83->157 PF01272 * GreA_GreB 5.3e-28 46.7 75/77  
:BLT:SWISS 1->158 GREA_NITOC 2e-85 100.0 %
:PROS 17->48|PS00829|GREAB_1
:PROS 121->137|PS00830|GREAB_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59024.1 GT:GENE ABA59024.1 GT:PRODUCT transcription elongation factor GreA GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2923264..2923740) GB:FROM 2923264 GB:TO 2923740 GB:DIRECTION - GB:PRODUCT transcription elongation factor GreA GB:PROTEIN_ID ABA59024.1 GB:DB_XREF GI:76884343 InterPro:IPR001437 InterPro:IPR006359 LENGTH 158 SQ:AASEQ MNKVPLTEKGAQQLREELQELKTVVRPKVVTAIAEARAHGDLKENAEYHAAREEQGFVEGRIRDLEHQLAHAQIIDVSKLQKDGRVVFGVTVDLVNIETDEEASYQIVGDLEANIKENKISINSPIARALIGKREGDEIQVQAPSGIILYEIAAIGYQ GT:EXON 1|1-158:0| SW:ID GREA_NITOC SW:DE RecName: Full=Transcription elongation factor greA;AltName: Full=Transcript cleavage factor greA; SW:GN Name=greA; OrderedLocusNames=Noc_2571; SW:KW Coiled coil; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->158|GREA_NITOC|2e-85|100.0|158/158| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 17->48|PS00829|GREAB_1|PDOC00651| PROS 121->137|PS00830|GREAB_2|PDOC00651| BL:PDB:NREP 1 BL:PDB:REP 4->132|1grjA|1e-40|57.4|129/151| RP:PDB:NREP 1 RP:PDB:REP 26->158|3bmbA|2e-32|24.2|124/135| RP:PFM:NREP 2 RP:PFM:REP 6->74|PF03449|7e-18|65.2|69/73|GreA_GreB_N| RP:PFM:REP 86->152|PF01272|7e-10|49.3|67/78|GreA_GreB| HM:PFM:NREP 2 HM:PFM:REP 2->74|PF03449|3.8e-34|56.9|72/74|GreA_GreB_N| HM:PFM:REP 83->157|PF01272|5.3e-28|46.7|75/77|GreA_GreB| GO:PFM:NREP 6 GO:PFM GO:0003677|"GO:DNA binding"|PF03449|IPR001437| GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF03449|IPR001437| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03449|IPR001437| GO:PFM GO:0003677|"GO:DNA binding"|PF01272|IPR001437| GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF01272|IPR001437| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01272|IPR001437| RP:SCP:NREP 2 RP:SCP:REP 3->79|1grjA1|1e-24|66.2|77/78|a.2.1.1| RP:SCP:REP 83->155|2etnA2|8e-20|37.0|73/79|d.26.1.2| HM:SCP:REP 2->79|1grjA1|5.4e-29|61.5|78/0|a.2.1.1|1/1|GreA transcript cleavage protein, N-terminal domain| HM:SCP:REP 80->158|1grjA2|6.7e-24|41.8|79/79|d.26.1.2|1/1|FKBP-like| OP:NHOMO 1177 OP:NHOMOORG 848 OP:PATTERN -------------------------------------------------------------------- 12211-1111111111111-1111111111111111111111111-11111-1111111111111111111111111111111-----111111111-12111211111111----1-------1111111111111111111112-------------------------------------32122--111111111111111111111111111111111121111111211111111111111111111122222222222222221221111111111111111111111111111111111111111111111111111122111111121211221111211112221122111111111111---111111111111121111111111111111111111-11111111111111111111111111111111111111111111111122222211111111111111111111111111111112222222222222222222222222222222222222222222222222222213222333222222222222222211111111111111222223212222132121111111111111111111121111112222222222122222222223222223221-1111111111122222222222222222-222222222222222222222222222222222222222222222222222212222222122221112111111111122222222222222222222222212111222222222222222222211111111122222222222222222222222221111111111111111111111111111-1-1111111111111111111111111111112- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 98.7 SQ:SECSTR ##cEEHccHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHcGGGTTcHHHHHHccccccHHHHHHHTcEEEcGGGccTTHcccTTcEEEEEETTTccEEEEEEEcGGGcccTTTEEETTcHHHHHHTTccTTcEEEEEETTTEEEEEEEEEEEc DISOP:02AL 158-159| PSIPRED ccEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcHHHcccccEEEEccEEEEEEcccccEEEEEEEcHHHcccccccEEEccHHHHHHcccccccEEEEEccccEEEEEEEEEEEc //