[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59032.1
DDBJ      :             aminopeptidase P. Metallo peptidase. MEROPS family M24B
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  684/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.55.2d.127.1
:443 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->438 1jawA PDBj 2e-98 43.6 %
:RPS:PDB   3->437 2bwtA PDBj 6e-97 43.2 %
:RPS:SCOP  1->173 1a16A1  c.55.2.1 * 3e-34 36.6 %
:RPS:SCOP  174->438 1a16A2  d.127.1.1 * 2e-74 47.1 %
:HMM:SCOP  1->173 2bwvA1 c.55.2.1 * 2.6e-52 42.8 %
:HMM:SCOP  174->439 2bwvA2 d.127.1.1 * 4.6e-86 46.6 %
:RPS:PFM   1->126 PF05195 * AMP_N 3e-29 47.2 %
:RPS:PFM   181->411 PF00557 * Peptidase_M24 5e-34 45.5 %
:HMM:PFM   180->412 PF00557 * Peptidase_M24 1.6e-68 51.2 201/203  
:HMM:PFM   1->132 PF05195 * AMP_N 3e-45 43.5 131/134  
:BLT:SWISS 4->438 AMPP_ECOLI 9e-98 43.6 %
:PROS 347->359|PS00491|PROLINE_PEPTIDASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59032.1 GT:GENE ABA59032.1 GT:PRODUCT aminopeptidase P. Metallo peptidase. MEROPS family M24B GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2931676..2933007 GB:FROM 2931676 GB:TO 2933007 GB:DIRECTION + GB:PRODUCT aminopeptidase P. Metallo peptidase. MEROPS family M24B GB:PROTEIN_ID ABA59032.1 GB:DB_XREF GI:76884351 InterPro:IPR000994 InterPro:IPR001131 InterPro:IPR007865 LENGTH 443 SQ:AASEQ MEAKEFARRRKHLLQMMGEGSIAILPTASIYPRNRDVMFPFRADSDFYYLTGFPEPEAVAVFAPGRKHGEYLLFCREQDPEKEIWEGRRAGTQGACKNYGADDSFPITDIDDILPGLLEDKARVYYAMGYYPAFDQRMIGWVNHIRRASRAGKRPPGEFIALDHLLHEMRLIKSAQEIRTMREAARISAKAHIRAMENCHPGIMEYQIEAEYLHHFFSHGCRAPAYPSIVGSGGNACILHYTDNNARLKKGDLLLVDAGAEYDYYAADITRTFPVSGRFSSAQRAIYELVLEAQLAAIAEVQPGNHWNQPHEAAVRVLTEGLAALGLLKGRVSTLLKKEHYRRFYMHRTGHWLGMDVHDVGDYKVDGEWRAFEPGMTLTVEPGVYIPADSQGVAKKWWNIGVRIEDDVLVTKEGCELLSADVPKTVDEIEALMASSQRGASAS GT:EXON 1|1-443:0| BL:SWS:NREP 1 BL:SWS:REP 4->438|AMPP_ECOLI|9e-98|43.6|433/441| PROS 347->359|PS00491|PROLINE_PEPTIDASE|PDOC00417| SEG 257->268|dagaeydyyaad| BL:PDB:NREP 1 BL:PDB:REP 4->438|1jawA|2e-98|43.6|433/440| RP:PDB:NREP 1 RP:PDB:REP 3->437|2bwtA|6e-97|43.2|433/440| RP:PFM:NREP 2 RP:PFM:REP 1->126|PF05195|3e-29|47.2|125/135|AMP_N| RP:PFM:REP 181->411|PF00557|5e-34|45.5|200/203|Peptidase_M24| HM:PFM:NREP 2 HM:PFM:REP 180->412|PF00557|1.6e-68|51.2|201/203|Peptidase_M24| HM:PFM:REP 1->132|PF05195|3e-45|43.5|131/134|AMP_N| GO:PFM:NREP 3 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF05195|IPR007865| GO:PFM GO:0030145|"GO:manganese ion binding"|PF05195|IPR007865| GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 2 RP:SCP:REP 1->173|1a16A1|3e-34|36.6|172/175|c.55.2.1| RP:SCP:REP 174->438|1a16A2|2e-74|47.1|263/264|d.127.1.1| HM:SCP:REP 1->173|2bwvA1|2.6e-52|42.8|173/0|c.55.2.1|1/1|Creatinase/prolidase N-terminal domain| HM:SCP:REP 174->439|2bwvA2|4.6e-86|46.6|264/0|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 1667 OP:NHOMOORG 923 OP:PATTERN 11111122222222221211-2--1111--21111-1--111--------111-21222231112-11 124-412122222-1--11-112211111111221212--111111111222111113112211211344111111111-2-2111111111-1--1----21212122-111111111111112--11--1112122211111222222221--1111111111112222111111111111-1-3211122244444444244444422222244424433222222225222222222222222222222221323322221122221212222221122122111222222222221111112111111122111222212-223333333232-311222211---3-1-1--111111211111111211------------------------1--11-11-----------1--1------11-1-------11-1----------------------------------------------------1-1-11111111111111111111111111211121111111-1111112111111111121-------111111212-1122111--111-1111---11112111-1-11-----11111111111111111-1-421441222111112311113133133--11221------32221223333333333-33333333333333333332221122223222222222222221333222211111111111111---2-----1111112111111111111-21111211111---1122221111111111111---------1--------------2233333333111111-2112222----------2-1111-111111111111-111----12111-111-11 ----222-31112233442333333333333333333333333333443423533333323322222222322222222222222212-33242222222321445-21245423241221222332225P2-332121221231122223-132332233722221233-3242124172222222243321122333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 438 STR:RPRED 98.9 SQ:SECSTR ccHHHHHHHHHHHHHHccccEEEEEEcccccEEETTEEccccccHHHHHHHcccccccEEEEEEccccEEEEEEEccccHHHHHHHccccHHHHHHHHHTccEEEEGGGHHHHHHHHHTTccEEEEcTTccHHHHHHHHHHHHHHHHTGGGTcccccEEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHTTccccccccEEEEGGGGGcTTcccccccccTTcEEEEEEccEETTEEccEEEEEETTccccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHHHHTTcccccHHHHHHTTTTTTTccccccccccccccccccccTGGGcccccTTcEEEEccEEEEccTTccccGGGTTEEEEccEEEEEccccEEEccTTccccHHHHHHHHHHHHT##### DISOP:02AL 440-443| PSIPRED ccHHHHHHHHHHHHHHHccccEEEEEccccEEccccccccccccccEEEEEcccccccEEEEEEEcccccEEEEEccccHHHHHHccccccHHHHHHHHcccHHccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccEEccccEEEEEEEEEEccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccEEEEccccccccccccccccccEEccccEEEEcccEEEcccccccccccccEEEEEEEEEEEcccccEEEcccccccHHHHHHHHHHHccccccc //