[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59049.1
DDBJ      :             Leucyltransferase
Swiss-Prot:LFTR_NITOC   RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;         EC=2.3.2.6;AltName: Full=L/F-transferase;AltName: Full=Leucyltransferase;AltName: Full=Phenyalanyltransferase;

Homologs  Archaea  0/68 : Bacteria  449/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:240 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->218 2z3kA PDBj 8e-66 53.3 %
:RPS:PDB   15->239 2dptA PDBj 4e-92 50.7 %
:RPS:SCOP  10->229 2cxaA1  d.108.1.6 * 5e-90 50.7 %
:HMM:SCOP  4->237 2cxaA1 d.108.1.6 * 6.7e-91 54.7 %
:RPS:PFM   39->209 PF03588 * Leu_Phe_trans 2e-64 62.0 %
:HMM:PFM   38->209 PF03588 * Leu_Phe_trans 1e-75 54.1 172/173  
:BLT:SWISS 1->240 LFTR_NITOC e-146 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59049.1 GT:GENE ABA59049.1 GT:PRODUCT Leucyltransferase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2951216..2951938 GB:FROM 2951216 GB:TO 2951938 GB:DIRECTION + GB:PRODUCT Leucyltransferase GB:PROTEIN_ID ABA59049.1 GB:DB_XREF GI:76884368 InterPro:IPR004616 LENGTH 240 SQ:AASEQ MEEFHCIDSNRLANAFPHPRLALAEPNGLLAVGGDLSPERLIMAYRQGIFPWYNQGQPILWWSPDPRLILFPQQLHISRSLHKRLRRGIYQVTLDLDFPGVIQACASPRQDGEGTWITSEMKSAYNRLHEMGIAHSVETWEDKELIGGLYGVSIGRIFFGESMFSKRPDASKIAFVYLCRQLQRWGFPLIDCQIQSEHLQRLGAQTLPRNKFLHWLHEFSNSPSLKRPWHFDPDLLKNSL GT:EXON 1|1-240:0| SW:ID LFTR_NITOC SW:DE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase; EC=2.3.2.6;AltName: Full=L/F-transferase;AltName: Full=Leucyltransferase;AltName: Full=Phenyalanyltransferase; SW:GN Name=aat; OrderedLocusNames=Noc_2596; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->240|LFTR_NITOC|e-146|100.0|240/240| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 7->218|2z3kA|8e-66|53.3|210/231| RP:PDB:NREP 1 RP:PDB:REP 15->239|2dptA|4e-92|50.7|221/232| RP:PFM:NREP 1 RP:PFM:REP 39->209|PF03588|2e-64|62.0|171/172|Leu_Phe_trans| HM:PFM:NREP 1 HM:PFM:REP 38->209|PF03588|1e-75|54.1|172/173|Leu_Phe_trans| GO:PFM:NREP 2 GO:PFM GO:0008914|"GO:leucyltransferase activity"|PF03588|IPR004616| GO:PFM GO:0030163|"GO:protein catabolic process"|PF03588|IPR004616| RP:SCP:NREP 1 RP:SCP:REP 10->229|2cxaA1|5e-90|50.7|215/229|d.108.1.6| HM:SCP:REP 4->237|2cxaA1|6.7e-91|54.7|232/0|d.108.1.6|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 455 OP:NHOMOORG 452 OP:PATTERN -------------------------------------------------------------------- ---1-------------------------------------1111--1--------------11------------------1--1-----1-------1111111-111---------------11-1111111111111---1-11111111111-----111111111------------111---------------------------------------------------------------------------------------------------------------------------------------------1--------------------1-------------------------1-1111-----11111111121111111111-1-1-11111111111111111111111111-1111111111111111111111111111------------------------------11111111-1111111111111111111111111111111111111111111111111211111111111111111111111111111111-------1-111111111--1-111111---------11111111111-1111111111111111111111111--11111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111--11-----111111111---------------11111111111111111111111111111---------11111111111111-11111111121111--1-111111--------1-------------------------------------1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 232 STR:RPRED 96.7 SQ:SECSTR ######cEEcTTccccccGGGccTTTTTEEEEEccccHHHHHHHHHTTcEEcccTTcccEEEccccEEEEcGGGccccHHHHHHHHTcccEEEEcccHHHHHHHHTTcccccccTTccHHHHHHHHHHHHTTcEEEEEEEETTEEEEEEEEEEETTEEEEEEEEEccTTHHHHHHHHHHHHHHHTTccEEEEEcccHHHHHTTcEEEcHHHHHHHHHHHTTcccc#cTTTTccEEEEcc# DISOP:02AL 1-2| PSIPRED ccccEEccccccccccccHHHHccccccEEEEcccccHHHHHHHHHccccccccccccEEEEcccccEEcccccccccHHHHHHHccccEEEEEEccHHHHHHHHHccccccccccccHHHHHHHHHHHHcccEEEEEEEEccEEEEEHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHcccEEEEEccccHHHHHcccEEccHHHHHHHHHHHHHcccccccccccHHHHHHcc //