[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59050.1
DDBJ      :             Arginyltransferase
Swiss-Prot:ATE_NITOC    RecName: Full=Putative arginyl-tRNA--protein transferase;         Short=R-transferase;         Short=Arginyltransferase;         EC=2.3.2.8;

Homologs  Archaea  0/68 : Bacteria  266/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:238 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  78->235 1lrzA3 d.108.1.4 * 3.1e-22 22.6 %
:RPS:PFM   10->93 PF04376 * ATE_N 5e-17 41.7 %
:RPS:PFM   105->226 PF04377 * ATE_C 1e-15 39.5 %
:HMM:PFM   105->232 PF04377 * ATE_C 1.7e-45 39.4 127/128  
:HMM:PFM   9->92 PF04376 * ATE_N 5.1e-30 33.3 84/88  
:BLT:SWISS 1->238 ATE_NITOC e-135 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59050.1 GT:GENE ABA59050.1 GT:PRODUCT Arginyltransferase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2951935..2952651 GB:FROM 2951935 GB:TO 2952651 GB:DIRECTION + GB:PRODUCT Arginyltransferase GB:PROTEIN_ID ABA59050.1 GB:DB_XREF GI:76884369 InterPro:IPR007471 InterPro:IPR007472 LENGTH 238 SQ:AASEQ MTSYWNFDFYLSPPQPCSYLPDQTATNLFADPEAAMDIARYSTLVRLGFRRSGRLVYRPRCLHCSACQPARIPVAQFRPNRSQRRAWKFNQDLSACYRPVEFRAEHFDLFRRYLGTRHPQGGMDDSTPEDYLNFIASGWNETSLIEFRDGKEQLLAVAAVDALTDGLSAVYSFFDPNAKKRSLGTYIILWEIGEAKALNLPYVYLGYWIKNSHKMSYKSAFHPLEVYQDKKWSILKET GT:EXON 1|1-238:0| SW:ID ATE_NITOC SW:DE RecName: Full=Putative arginyl-tRNA--protein transferase; Short=R-transferase; Short=Arginyltransferase; EC=2.3.2.8; SW:GN Name=ate; OrderedLocusNames=Noc_2597; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->238|ATE_NITOC|e-135|100.0|238/238| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 154->167|llavaavdaltdgl| RP:PFM:NREP 2 RP:PFM:REP 10->93|PF04376|5e-17|41.7|84/85|ATE_N| RP:PFM:REP 105->226|PF04377|1e-15|39.5|119/127|ATE_C| HM:PFM:NREP 2 HM:PFM:REP 105->232|PF04377|1.7e-45|39.4|127/128|ATE_C| HM:PFM:REP 9->92|PF04376|5.1e-30|33.3|84/88|ATE_N| GO:PFM:NREP 4 GO:PFM GO:0004057|"GO:arginyltransferase activity"|PF04376|IPR007471| GO:PFM GO:0016598|"GO:protein arginylation"|PF04376|IPR007471| GO:PFM GO:0004057|"GO:arginyltransferase activity"|PF04377|IPR007472| GO:PFM GO:0016598|"GO:protein arginylation"|PF04377|IPR007472| HM:SCP:REP 78->235|1lrzA3|3.1e-22|22.6|155/0|d.108.1.4|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 268 OP:NHOMOORG 267 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------------------------1111-1111111111111111111111111111111111111111111111111111121111-------111111----1-1---------------------11--1----11111--1-------11-11111111111111-1111111111111111111---1111--------------------------------------------------------------------------------------------1---------1111----------------1111111--11111111111111111111----------1111111111111111111111111111--1---1111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 236-238| PSIPRED cccccccEEEccccccccccccccccEEEEEccccccHHHHHHHHHccHHHcccEEEEcccccccccEEEEEEHHHHHccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEccEEcccccccccccccccEEEEcccEEEEcccc //