[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59053.1
DDBJ      :             conserved hypothetical protein YbeL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  93/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->167 PF07295 * DUF1451 2e-18 35.3 %
:HMM:PFM   25->168 PF07295 * DUF1451 5e-48 37.9 140/146  
:BLT:SWISS 9->167 YBEL_ECOLI 2e-16 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59053.1 GT:GENE ABA59053.1 GT:PRODUCT conserved hypothetical protein YbeL GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2953670..2954197 GB:FROM 2953670 GB:TO 2954197 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein YbeL GB:PROTEIN_ID ABA59053.1 GB:DB_XREF GI:76884372 LENGTH 175 SQ:AASEQ MDTQDKDARLARAYHKMVSRVRSLVGEEESKDEPEVSKGIEAAKQKAVETGELSQEEADRLGEYLRRDLEDAARYLSDTGKALSDWLMLDLELIEEQLLDAFSQVADKTRFELALWAEQARHAQDYQTGEIIGIGTFACLHCGERLHFHQASPLPPCPKCHHTLFQRLKRSEERS GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 9->167|YBEL_ECOLI|2e-16|29.4|153/160| SEG 87->99|lmldlelieeqll| RP:PFM:NREP 1 RP:PFM:REP 25->167|PF07295|2e-18|35.3|139/147|DUF1451| HM:PFM:NREP 1 HM:PFM:REP 25->168|PF07295|5e-48|37.9|140/146|DUF1451| OP:NHOMO 94 OP:NHOMOORG 93 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------1-----111-----------1111-------1111111111111111-112111111111111111111111---1111111111111111111111111-111111111111---------------11--------------------------------------------------------11------11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 24-39, 167-175| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccEEEHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccc //