[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59063.1
DDBJ      :             RNA-binding protein, RNP-1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.7
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->75 1rk8A PDBj 3e-09 34.7 %
:RPS:PDB   3->81 1cvjD PDBj 2e-15 19.0 %
:RPS:SCOP  3->80 1cvjA1  d.58.7.1 * 3e-16 19.2 %
:HMM:SCOP  2->78 1uawA_ d.58.7.1 * 1.3e-17 39.0 %
:RPS:PFM   4->72 PF00076 * RRM_1 3e-10 40.6 %
:HMM:PFM   4->72 PF00076 * RRM_1 7.1e-19 39.7 68/70  
:BLT:SWISS 2->78 RBPB_ANASP 1e-11 41.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59063.1 GT:GENE ABA59063.1 GT:PRODUCT RNA-binding protein, RNP-1 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2964452..2964727 GB:FROM 2964452 GB:TO 2964727 GB:DIRECTION + GB:PRODUCT RNA-binding protein, RNP-1 GB:PROTEIN_ID ABA59063.1 GB:DB_XREF GI:76884382 InterPro:IPR000504 LENGTH 91 SQ:AASEQ MITLFIRGLPTSTTEESLTALFADYGTVRSLTLHKDLFTGQARGTALINMEGHEGRAAIAALDGSQLQGRTIYVNQTKEEKRRGRGGRRRR GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 2->78|RBPB_ANASP|1e-11|41.6|77/103| SEG 82->90|rrgrggrrr| BL:PDB:NREP 1 BL:PDB:REP 4->75|1rk8A|3e-09|34.7|72/87| RP:PDB:NREP 1 RP:PDB:REP 3->81|1cvjD|2e-15|19.0|79/161| RP:PFM:NREP 1 RP:PFM:REP 4->72|PF00076|3e-10|40.6|69/71|RRM_1| HM:PFM:NREP 1 HM:PFM:REP 4->72|PF00076|7.1e-19|39.7|68/70|RRM_1| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| RP:SCP:NREP 1 RP:SCP:REP 3->80|1cvjA1|3e-16|19.2|78/80|d.58.7.1| HM:SCP:REP 2->78|1uawA_|1.3e-17|39.0|77/0|d.58.7.1|1/1|RNA-binding domain, RBD| OP:NHOMO 46 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------1---------1------------------------1-----------12-1----------------24411-----------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12-32-221---------------1-------------------------1---------1--------------------------1---------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1-- --------21----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 89.0 SQ:SECSTR GcEEEEEcccTTccHHHHHHHHGGGccEEEEEEEEcTTTccEEEEEEEEEccHHHHHHHHHHTTcEETTEEcEEEEccccT########## DISOP:02AL 74-91| PSIPRED cEEEEEccccccccHHHHHHHHHccccEEEEEEEEEccccccccEEEEEEccHHHHHHHHHccccEEccEEEEEEEccccccccccccccc //