[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59076.1
DDBJ      :             Coenzyme PQQ biosynthesis protein E
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  233/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:385 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->136 2fb2B PDBj 2e-06 33.3 %
:RPS:PDB   16->302 3ciwA PDBj 3e-26 12.3 %
:RPS:SCOP  21->269 1tv7A  c.1.28.3 * 2e-32 20.9 %
:HMM:SCOP  10->324 1tv8A_ c.1.28.3 * 2.7e-72 30.3 %
:RPS:PFM   26->161 PF04055 * Radical_SAM 3e-06 25.0 %
:HMM:PFM   26->180 PF04055 * Radical_SAM 2.6e-24 21.9 155/166  
:HMM:PFM   212->255 PF09250 * Prim-Pol 0.00059 31.8 44/162  
:BLT:SWISS 17->385 PQQE_METCA e-147 66.2 %
:PROS 26->37|PS01305|MOAA_NIFB_PQQE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59076.1 GT:GENE ABA59076.1 GT:PRODUCT Coenzyme PQQ biosynthesis protein E GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2978192..2979349 GB:FROM 2978192 GB:TO 2979349 GB:DIRECTION + GB:PRODUCT Coenzyme PQQ biosynthesis protein E GB:PROTEIN_ID ABA59076.1 GB:DB_XREF GI:76884395 InterPro:IPR000385 InterPro:IPR007197 InterPro:IPR011843 LENGTH 385 SQ:AASEQ MAGSPPKINHFTGNARTQPLWLLAELTYACPLQCPYCSNPLDFANYKHELSTKDWLRVFHEARAMGAAQLGFSGGEPLARRDLEVLITEARKLGYYTNLITSGIGMDEDRIAAFKTARLDHIQISFQAASEDLNNRLAGADVFQYKLAMARAVKKHGYPMVLCFVLHRYNIDQIGKILDLAIELKADYVELATTQYYGWAWHNRNHLLPTREQLERAEALARQYQVRTQGKMKIYYVVPDYYENRPKACMNGWGNIFLTIAPDGTALPCHAARQLPGLTLPNVKSHSIEWIWYESPDFNLFRGQGWMKEPCRSCPERFKDFGGCRCQAYLLTGDARNTDPVCDLSPHHQTVVDAITAAHQQTPLPANKSKPPIFRHLRNSKKFCG GT:EXON 1|1-385:0| BL:SWS:NREP 1 BL:SWS:REP 17->385|PQQE_METCA|e-147|66.2|364/373| PROS 26->37|PS01305|MOAA_NIFB_PQQE|PDOC01009| BL:PDB:NREP 1 BL:PDB:REP 22->136|2fb2B|2e-06|33.3|114/326| RP:PDB:NREP 1 RP:PDB:REP 16->302|3ciwA|3e-26|12.3|285/344| RP:PFM:NREP 1 RP:PFM:REP 26->161|PF04055|3e-06|25.0|136/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 26->180|PF04055|2.6e-24|21.9|155/166|Radical_SAM| HM:PFM:REP 212->255|PF09250|0.00059|31.8|44/162|Prim-Pol| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 21->269|1tv7A|2e-32|20.9|244/327|c.1.28.3| HM:SCP:REP 10->324|1tv8A_|2.7e-72|30.3|310/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 369 OP:NHOMOORG 275 OP:PATTERN 11-211412222224323-112222111-11----1------------245543----1-21112--- --3-------1---111----1--12-----11---2111-1-2------------------1---2------------2111--------1---------------1--------------------11---1-----------11-1111-----------------1------------------1---1----------------1--------------1-------1-------------------------------------------1--------1-11---------------------------112----11-11----------2-11------1-----11211141-1111-12----1----------11111-1-11111------------11111111----1-----1---11-1---2-211112-111111111111111-----------------------------------------11111111111111-11111-1-112211--12121-11-1--11--11111------------112-112-2331212221222-313------1142-------------------------------1-2----------------------1---1----------1----1------------------------------111--------------------------------------------------------1-11----------------111-111---1-222212211111131111-------------------------11111111--------------------------------------------------1-11--1-1-1-- -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 78.7 SQ:SECSTR ########EEEEEEccEEEEEEEEEEEcccccccTTcTTcTTcccccccccHHHHHHHHHHHHHTTccEEEEEEcccGGTTHHHHHHHHHHHTTTcEEEEEccccccHHHHHHHHHTTccEEEcccccccHHHHHHHcTccHHHHHHHHHHHHTTcEEEEccEEccTTccHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHcTTccccccHHHHHHcTTHHHHccEEccccccTTTGGGccccTTcTTTTccTTcHHH#HHHHHHHTTcEEcccccccccccccccc##cccccc####################################################################### DISOP:02AL 1-13, 358-373| PSIPRED ccccccHHHccccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHccccEEEEEEccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHcEEcccHHcccccccccccccEEEEEcccccEEEccccccccccEEEccccccHHHHHcccHHHHHHcccccccccccccccccccccccHHHHHHHcccccccccccEEccHHHHHHHHHHHHHHHHccccccccccccccccccHHHcc //