[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59080.1
DDBJ      :             L-lysine 2,3-aminomutase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  378/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
b.102.1c.1.28c.13.2
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->333 2a5hB PDBj 2e-39 36.7 %
:RPS:PDB   13->334 2a5hB PDBj 2e-32 31.1 %
:RPS:SCOP  53->168 1fjrA  b.102.1.1 * 9e-22 10.4 %
:RPS:SCOP  183->275 1h4xA  c.13.2.1 * 4e-04 10.0 %
:HMM:SCOP  98->323 1tv8A_ c.1.28.3 * 1.4e-24 24.3 %
:RPS:PFM   113->240 PF04055 * Radical_SAM 1e-04 33.0 %
:HMM:PFM   114->262 PF04055 * Radical_SAM 3.3e-12 22.2 144/166  
:BLT:SWISS 14->333 YJEK_ECOLI 6e-85 47.6 %
:PROS 119->142|PS00028|ZINC_FINGER_C2H2_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59080.1 GT:GENE ABA59080.1 GT:PRODUCT L-lysine 2,3-aminomutase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2981254..2982261 GB:FROM 2981254 GB:TO 2982261 GB:DIRECTION + GB:PRODUCT L-lysine 2,3-aminomutase GB:PROTEIN_ID ABA59080.1 GB:DB_XREF GI:76884399 InterPro:IPR003739 InterPro:IPR007087 InterPro:IPR007197 LENGTH 335 SQ:AASEQ MITQSSHLLQKPVWQAALSQAVRNPQELLELTGLDNHPQIASEATRRQFPLRVPRSYIARMKKGDPNDPLFRQVFPLHAEDQISPGFNTDPVGDLAAMPAPGVLQKYTGRVLLVATGACAIHCRYCFRRHFPYGDHNPAQEHWKRALQYIAQNQSIREVILSGGDPLTLADNRLAELAQTLATISHVKRLRIHTRLPVVLPERVDHHLLQWLEGTSLQKVVVIHANHVNELDDRVAAALNDLSRAGCRLFNQTVLLRGINDKVSALSDLSEGLFDTGVLPYYLHLLDKVQGAAHFEVDIITAQRLHRTLRARLPGYLVPLLVQEQAGAPSKLPRS GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 14->333|YJEK_ECOLI|6e-85|47.6|319/342| PROS 119->142|PS00028|ZINC_FINGER_C2H2_1|PDOC00028| BL:PDB:NREP 1 BL:PDB:REP 57->333|2a5hB|2e-39|36.7|264/401| RP:PDB:NREP 1 RP:PDB:REP 13->334|2a5hB|2e-32|31.1|315/401| RP:PFM:NREP 1 RP:PFM:REP 113->240|PF04055|1e-04|33.0|115/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 114->262|PF04055|3.3e-12|22.2|144/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 53->168|1fjrA|9e-22|10.4|115/188|b.102.1.1| RP:SCP:REP 183->275|1h4xA|4e-04|10.0|90/111|c.13.2.1| HM:SCP:REP 98->323|1tv8A_|1.4e-24|24.3|214/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 497 OP:NHOMOORG 418 OP:PATTERN ---1-------------------------------11113212--22-12111------1------11 ----1---------------------------------1---------------------121-31----1----------1-21211------11------------1---------------12--1-311-12-----222--1-----------------------1------------111-------1111111111111111-211111111--1---------21------------------------------------------------------------------------------------------121-------------1------11---1---2113211-311--21-1---11111-----1121311112111------------11111111-2-11111111111111111---11111---1111111111111111-----------------------------------------111--1----------------------------------1---------------------1--12522133--2----11111113222223222-----------------------1------12112111-----------------1-1-1121211----11111111111111111-11-111111111111111111-112111111111111111111111111111-111111111111--11111111111121111111111111-111111111111111----------------1-11111111111111111111111111111112111111111-222222--------11--------------------------122221111112- ---------------1111----1-1---------------------1---------11111------------------------------1---------------2-2-----------------------------------------------------------------------------11--111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 322 STR:RPRED 96.1 SQ:SECSTR ############cHHHHHHTccccHHHHHTTccccHHHHHHHHTcTTccccccHHHHHTTccTTcTTcHHHHHHcccGGGGcccTTccccTTcTTTccccTTEEcccccEEEEEEEEEcccccTTcTTTTTTcTccccccHHHHHHHHHHHTcTTccEEEEEEccTTcccHHHHHHHHHHHHTcTTccEEEEEccHHHHcGGGccHHHHHHHHHTTccEEEEEccccGGGccHHHHHHHHHHHHTTccEEEEEEEcTTTTccHHHHHHHHHHHHHTTEEEEEEEEccccTTcGGGcccHHHHHHHHHTTTTTccGGGccEEEEEETTTTEEEEc# DISOP:02AL 1-3, 132-142, 330-335| PSIPRED cccccccccccccHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHcccHHHcccccccccccccHHHccccccccEEcccEEEEEEccccccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEccccEEEcccccHHHHHHHHHccccEEEEEEEccHHHccHHHHHHHHHHHHcccEEEEccEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccccccccccc //