[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59085.1
DDBJ      :             Serine-type D-Ala-D-Ala carboxypeptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  691/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
b.105.1e.3.1
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->367 1nzuA PDBj 2e-72 43.0 %
:RPS:PDB   39->277 3dtmA PDBj 1e-38 16.3 %
:RPS:SCOP  38->275 1hd8A2  e.3.1.1 * 2e-84 47.6 %
:RPS:SCOP  276->368 1hd8A1  b.105.1.1 * 8e-21 29.0 %
:HMM:SCOP  1->276 1tvfA2 e.3.1.1 * 3.4e-86 43.6 %
:HMM:SCOP  276->368 1hd8A1 b.105.1.1 * 3.6e-21 35.5 %
:RPS:PFM   38->257 PF00768 * Peptidase_S11 5e-60 52.3 %
:RPS:PFM   276->360 PF07943 * PBP5_C 4e-12 32.9 %
:HMM:PFM   31->255 PF00768 * Peptidase_S11 1.2e-79 46.2 225/241  
:HMM:PFM   276->366 PF07943 * PBP5_C 5.8e-22 30.8 91/91  
:BLT:SWISS 38->381 DACA_ECOLI 1e-72 42.4 %
:PROS 104->111|PS00867|CPSASE_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59085.1 GT:GENE ABA59085.1 GT:PRODUCT Serine-type D-Ala-D-Ala carboxypeptidase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2986229..2987377) GB:FROM 2986229 GB:TO 2987377 GB:DIRECTION - GB:PRODUCT Serine-type D-Ala-D-Ala carboxypeptidase GB:PROTEIN_ID ABA59085.1 GB:DB_XREF GI:76884404 InterPro:IPR001967 InterPro:IPR005479 LENGTH 382 SQ:AASEQ MKSRSFLLSWYCLLLLFLGAEAWGQPLPIPAPPSLSAKAYLLQDFATGRVLAESQADERIEPASITKLMTAYVVFKELKQGRIHLADEVLISEKAWRTGGSRTFIEVNTRVPVETLIKGMIIQSGNDASVALAEHVGGTEEIFAALMNQQAQLLGMTGSHFVNSTGLPHSNHYMTARDIATLGRAIIRDFPKYYSWYSEQAFTYNGITQYNRNLLLRRDSSVDGFKTGHTNSAGYCLASSAMRDGMRLIAVVMGTGSPKIRAQESLALLNYGFRFYDTRSIYAAKEAVTKVRVWQGANKELPLGLVDDLSVTLQRGRWEELSSSLRVQNTITAPVTEGQNLGIVTVNLGDKVLLKRPLVALTAVPEGSWWQRLIDWILSFFA GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 38->381|DACA_ECOLI|1e-72|42.4|344/403| PROS 104->111|PS00867|CPSASE_2|PDOC00676| TM:NTM 1 TM:REGION 4->24| SEG 7->18|llswycllllfl| SEG 26->37|plpipappslsa| BL:PDB:NREP 1 BL:PDB:REP 38->367|1nzuA|2e-72|43.0|330/347| RP:PDB:NREP 1 RP:PDB:REP 39->277|3dtmA|1e-38|16.3|239/263| RP:PFM:NREP 2 RP:PFM:REP 38->257|PF00768|5e-60|52.3|220/235|Peptidase_S11| RP:PFM:REP 276->360|PF07943|4e-12|32.9|85/91|PBP5_C| HM:PFM:NREP 2 HM:PFM:REP 31->255|PF00768|1.2e-79|46.2|225/241|Peptidase_S11| HM:PFM:REP 276->366|PF07943|5.8e-22|30.8|91/91|PBP5_C| GO:PFM:NREP 4 GO:PFM GO:0006508|"GO:proteolysis"|PF00768|IPR001967| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF00768|IPR001967| GO:PFM GO:0006508|"GO:proteolysis"|PF07943|IPR012907| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF07943|IPR012907| RP:SCP:NREP 2 RP:SCP:REP 38->275|1hd8A2|2e-84|47.6|227/243|e.3.1.1| RP:SCP:REP 276->368|1hd8A1|8e-21|29.0|93/94|b.105.1.1| HM:SCP:REP 1->276|1tvfA2|3.4e-86|43.6|273/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| HM:SCP:REP 276->368|1hd8A1|3.6e-21|35.5|93/94|b.105.1.1|1/1|Penicillin-binding protein associated domain| OP:NHOMO 1644 OP:NHOMOORG 696 OP:PATTERN -------------------------------------------------------------------- 1--121-1111-1-21122-23111222222133331-1--111-------1--------21--111524--------11111-1-------------------------1111111-1111111111-11111-1---------2---------------------------------------------43388888998898899844443389933344222222224411111111111111121-21114111122112222111211221112222333211111111111112333333332333211111111334344444444443444554444445225242366554234333333-12-1-111123333333333333333344444343444-333333334422444455455544332222222222222222222222222232211111111----11111111111111111111211222232112123444411325555342222122112222222222242222232222222222221122221-----1-22-111-1-1---1--------121--------------------1---33332121111112222222122221211211--11111------44334444444434443-44544444444444444434443322244434444444242345234322321333334333333--11111111111212212121111222111-13333333222212222212222222222211111111111114333333322222111111111111111-------1111111111------------------------------------212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------------1--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 332 STR:RPRED 86.9 SQ:SECSTR #####################################cEEEEEETTTccEEEEEcTTccEEcGGGHHHHHHHHHHHHHHTTcccTTcEEcccGGGcccccTTGGGcTTTcEEHHHHHHHHHHcccHHHHHHHHHHHTHHHHHHHHHHHTTccccccccTTGGGcccTTccTTEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHTccccTTTGGGGccTTcEEEEEEEEccTTcEEEEEEEEcTTcccEEEEEEEEcccccHHHHHHHHHHHHHHHHTcccEccccEEEEETTEEEEEEEEEETTEEEEEEEETTTcTTTTcccEEEcccEEccccTTcEEEEEEEEETTEEEEEEEEEEccccccccc############# DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccEEEEEccccccccHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHcccccEEEEEcccEEEHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEEccccccccccEEcHHHHHHHHHHHHHHcHHHHHHHccEEEEEccEEEEEccccccccccEEEEEEccccccccEEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHHccEEEEEEEcccEEcEEEcccccccEEEEEEcccEEEEEEccccccEEEEEEEcccccccHHcccEEEEEEEEEccEEEEEEEcEEccccccccHHHHHHHHHHHHcc //