[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59088.1
DDBJ      :             aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
Swiss-Prot:GATC_NITOC   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C;         Short=Asp/Glu-ADT subunit C;         EC=6.3.5.-;

Homologs  Archaea  0/68 : Bacteria  229/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.137.12
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->95 2g5hC PDBj 1e-09 32.6 %
:RPS:PDB   7->95 2dqnC PDBj 9e-21 32.6 %
:RPS:SCOP  7->95 2df4C1  a.137.12.1 * 1e-20 32.6 %
:HMM:SCOP  2->93 2f2aC1 a.137.12.1 * 2.4e-28 42.4 %
:RPS:PFM   31->88 PF02686 * Glu-tRNAGln 3e-05 43.1 %
:HMM:PFM   20->88 PF02686 * Glu-tRNAGln 7.2e-24 44.9 69/72  
:BLT:SWISS 1->95 GATC_NITOC 1e-51 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59088.1 GT:GENE ABA59088.1 GT:PRODUCT aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2989717..2990004 GB:FROM 2989717 GB:TO 2990004 GB:DIRECTION + GB:PRODUCT aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C GB:PROTEIN_ID ABA59088.1 GB:DB_XREF GI:76884407 InterPro:IPR003837 InterPro:IPR004415 LENGTH 95 SQ:AASEQ MTLKTADVEYIAHLARLAIDSEAIPHYKHDLSRILEFVGQMNKVDTTNIEPMAHPLDAIQRLRPDEVTESDQWRTFQSIAPQVEAGVYLIPKVID GT:EXON 1|1-95:0| SW:ID GATC_NITOC SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C; EC=6.3.5.-; SW:GN Name=gatC; OrderedLocusNames=Noc_2635; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|GATC_NITOC|1e-51|100.0|95/95| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 7->95|2g5hC|1e-09|32.6|89/99| RP:PDB:NREP 1 RP:PDB:REP 7->95|2dqnC|9e-21|32.6|89/98| RP:PFM:NREP 1 RP:PFM:REP 31->88|PF02686|3e-05|43.1|58/72|Glu-tRNAGln| HM:PFM:NREP 1 HM:PFM:REP 20->88|PF02686|7.2e-24|44.9|69/72|Glu-tRNAGln| GO:PFM:NREP 1 GO:PFM GO:0006450|"GO:regulation of translational fidelity"|PF02686|IPR003837| RP:SCP:NREP 1 RP:SCP:REP 7->95|2df4C1|1e-20|32.6|89/99|a.137.12.1| HM:SCP:REP 2->93|2f2aC1|2.4e-28|42.4|92/0|a.137.12.1|1/1|Glu-tRNAGln amidotransferase C subunit| OP:NHOMO 229 OP:NHOMOORG 229 OP:PATTERN -------------------------------------------------------------------- -1---------------------------------------------------------------------------------------------------------------------------------------------------------11---1----1------11----1--1-----------1----------------1--11---1---1111111111----------------------------------------1--------------------------------------------------1--1-------------------1-----1-1------1--111111----1------111-111111111111111111111111-1111111111111--1-----1--111111111111111--------1111------------------------------------1-111-1111111111111111111111111111111111111111111111-111111111111111111-11---1-1----1-------------------1--------------------------11----11---------------------------1111---------------------------------------------------------------------------------------------11111111111111---------------11111111111111111111111111111---------1----------------------------111-------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 93.7 SQ:SECSTR ######HHHHHHHHHTccccHHHHHHHHHHHHHHHHHHGGGGGcccTTccccccccccccccccccccccccHHHHHTTcccccccccccccccc PSIPRED ccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccccHHHHHHHcHHHcccEEEcccccc //