[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59094.1
DDBJ      :             LSU ribosomal protein L33P
Swiss-Prot:RL33_NITOC   RecName: Full=50S ribosomal protein L33;

Homologs  Archaea  0/68 : Bacteria  447/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:51 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->51 1vs61 PDBj 4e-22 84.3 %
:RPS:PDB   1->49 3bbo3 PDBj 2e-09 34.7 %
:RPS:SCOP  1->51 1vs611  g.41.8.6 * 4e-12 84.3 %
:HMM:SCOP  1->49 2gya11 g.41.8.6 * 6.8e-17 69.4 %
:RPS:PFM   2->49 PF00471 * Ribosomal_L33 3e-05 58.3 %
:HMM:PFM   2->49 PF00471 * Ribosomal_L33 6e-25 58.3 48/48  
:BLT:SWISS 1->51 RL33_NITOC 4e-26 100.0 %
:PROS 17->36|PS00582|RIBOSOMAL_L33

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59094.1 GT:GENE ABA59094.1 GT:PRODUCT LSU ribosomal protein L33P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2995204..2995359 GB:FROM 2995204 GB:TO 2995359 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L33P GB:PROTEIN_ID ABA59094.1 GB:DB_XREF GI:76884413 InterPro:IPR001705 LENGTH 51 SQ:AASEQ MRDKIKLVSSAGTGHYYTTTKNKRTTPEKLEKKKYDPVVRKHVLYKEAKIK GT:EXON 1|1-51:0| SW:ID RL33_NITOC SW:DE RecName: Full=50S ribosomal protein L33; SW:GN Name=rpmG; OrderedLocusNames=Noc_2641; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->51|RL33_NITOC|4e-26|100.0|51/51| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 17->36|PS00582|RIBOSOMAL_L33|PDOC00503| BL:PDB:NREP 1 BL:PDB:REP 1->51|1vs61|4e-22|84.3|51/54| RP:PDB:NREP 1 RP:PDB:REP 1->49|3bbo3|2e-09|34.7|49/65| RP:PFM:NREP 1 RP:PFM:REP 2->49|PF00471|3e-05|58.3|48/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 2->49|PF00471|6e-25|58.3|48/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 1->51|1vs611|4e-12|84.3|51/54|g.41.8.6| HM:SCP:REP 1->49|2gya11|6.8e-17|69.4|49/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 472 OP:NHOMOORG 469 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11--111111111-1-1111---------111111111--11-1--1--1------------------------------------------------------------------111--------------------------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--111111111111111111111111111111111-111111111111-2----1---111111111111111111111111111111111111--11111--1111111111111-----1111111111111111111111111111111111111111111111111111111111111111111111111111----------------------------11---------------------------111111111111111111111111111111111-1111111-11111111111111111-11-1111111111111111111111111111111111111111111111111111-1111111111111111---------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- -----1--------------------------------------------------------------------------------------------1--1------2----------------------------------------------------------------1-111--1--111112--111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 100.0 SQ:SECSTR cccccEEccccccccccccEEccTTcccccccccccccccccccccccccc DISOP:02AL 50-52| PSIPRED cccEEEEEEEccccEEEEEEccccccccEEEEEEcccccccEEEEEEEEcc //