[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59098.1
DDBJ      :             ABC transporter, permease protein, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->187 PF01061 * ABC2_membrane 1.9e-08 25.4 142/208  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59098.1 GT:GENE ABA59098.1 GT:PRODUCT ABC transporter, permease protein, putative GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2998514..2999278 GB:FROM 2998514 GB:TO 2999278 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein, putative GB:PROTEIN_ID ABA59098.1 GB:DB_XREF GI:76884417 LENGTH 254 SQ:AASEQ MMVLTLALHELRRLFLSPLAWATLAVTQILFGYMFFTQVAYFLQFQPRLMGLPEAPGITEIVALPLFQNAAVIMLLIVPLMTMRLVADERRGRTLALLFSAPLSMTEIVIGKYLGTLAFFIIMTLLLVLMPLSLLLGGTLDFGLLAAGLLGLGLLIASFTAIGLFLSSLTQQTTVAAIGSFGVLLLLWIIDWAGNSGILKEGGEELFSYLSLFRHYQTLLEGQFNSSDIIYYLLIITTFLVLSIRRLDADRLPH GT:EXON 1|1-254:0| TM:NTM 7 TM:REGION 17->39| TM:REGION 61->83| TM:REGION 94->116| TM:REGION 119->141| TM:REGION 147->169| TM:REGION 173->195| TM:REGION 223->244| SEG 125->155|lllvlmplslllggtldfgllaagllglgll| SEG 229->238|iiyylliitt| HM:PFM:NREP 1 HM:PFM:REP 20->187|PF01061|1.9e-08|25.4|142/208|ABC2_membrane| OP:NHOMO 24 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------------------------------------------------------------------2---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-----------------11-1-------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------111---------111-------------------------------12-1------------------------------------------------------------11--------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 252-254| PSIPRED cHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //