[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59104.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59104.1 GT:GENE ABA59104.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3004009..3004485 GB:FROM 3004009 GB:TO 3004485 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59104.1 GB:DB_XREF GI:76884423 LENGTH 158 SQ:AASEQ MCIYHIGFPLIKYGIKFMNKINYLYLIAFLALFASTSVNAALNTEFDESDVLLHCERPPEADKYPEEVFNKIFPEITKRLQTYANKGKVLRAHYMGKLGQGFFVVVQGKNEEDAIANAKRIRQENLTTIYEATKDSKIGPQPDYCQMFSIGPVAVLPQ GT:EXON 1|1-158:0| SEG 23->34|ylyliaflalfa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 67-67,73-74,76-76,81-81,95-95,101-102,104-104,109-109,129-129,132-132,137-138,143-143,146-146,151-151,157-159| PSIPRED ccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccEEEccc //