[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59112.1
DDBJ      :             Protein of unknown function DUF163
Swiss-Prot:RLMH_NITOC   RecName: Full=Ribosomal RNA large subunit methyltransferase H;         EC=2.1.1.-;AltName: Full=rRNA (pseudouridine-N3-)-methyltransferase rlmH;AltName: Full=23S rRNA m3Psi1915 methyltransferase;

Homologs  Archaea  9/68 : Bacteria  646/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.116.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->155 1ns5B PDBj 1e-32 43.6 %
:RPS:SCOP  3->154 1ns5A  c.116.1.3 * 3e-49 43.0 %
:HMM:SCOP  1->154 1ns5A_ c.116.1.3 * 5e-63 43.1 %
:RPS:PFM   1->154 PF02590 * SPOUT_MTase 3e-36 44.8 %
:HMM:PFM   1->154 PF02590 * SPOUT_MTase 3.2e-52 42.2 154/155  
:BLT:SWISS 1->157 RLMH_NITOC 3e-91 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59112.1 GT:GENE ABA59112.1 GT:PRODUCT Protein of unknown function DUF163 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3014622..3015095) GB:FROM 3014622 GB:TO 3015095 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF163 GB:PROTEIN_ID ABA59112.1 GB:DB_XREF GI:76884431 InterPro:IPR003742 LENGTH 157 SQ:AASEQ MNIYVIAVGQRLPRWIGEGYQEYAQRLPRQCSLSLVEIAPARRGKSGHPTQWRQDECRRLLAAVPPNSKVIACDERGQSWSTEEVARRLQIWMNEGQDVVLLIGGPDGLAPLCLEQATGLWSLSSLTLPHGLVRVILAEQIYRAFSLLNRHPYHRAS GT:EXON 1|1-157:0| SW:ID RLMH_NITOC SW:DE RecName: Full=Ribosomal RNA large subunit methyltransferase H; EC=2.1.1.-;AltName: Full=rRNA (pseudouridine-N3-)-methyltransferase rlmH;AltName: Full=23S rRNA m3Psi1915 methyltransferase; SW:GN Name=rlmH; OrderedLocusNames=Noc_2659; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|RLMH_NITOC|3e-91|100.0|157/157| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 3->155|1ns5B|1e-32|43.6|149/151| RP:PFM:NREP 1 RP:PFM:REP 1->154|PF02590|3e-36|44.8|154/155|SPOUT_MTase| HM:PFM:NREP 1 HM:PFM:REP 1->154|PF02590|3.2e-52|42.2|154/155|SPOUT_MTase| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF02590|IPR003742| GO:PFM GO:0006364|"GO:rRNA processing"|PF02590|IPR003742| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF02590|IPR003742| RP:SCP:NREP 1 RP:SCP:REP 3->154|1ns5A|3e-49|43.0|151/153|c.116.1.3| HM:SCP:REP 1->154|1ns5A_|5e-63|43.1|153/0|c.116.1.3|1/1|alpha/beta knot| OP:NHOMO 670 OP:NHOMOORG 668 OP:PATTERN --------------------------------------111111-1-11------------------- 111-----------------------------------------------------1--------------1111111-1111-----1111-111---11111111--1--------------1--------------------------------1111-1---1----111-1111-111111-----111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111-111111111111-1111111-111111111111111111111111111111111111111-1111111111---11-11--1111111-1111111111111111-111111-1-11111111111-1111111111111111111111111111111111111111111------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111----11111-11111111111111111111-1-----111111---1----------11111111111111111111111111111111--11111------11111111111111111-1121111111111111111111111111111111111111111111111111-111111111111---1-1--1111111111111111111111111111111111111111111111111111111-1-11-1-11111111111111111111111111111--1-----------------1----1-1-1-1-----11--11111-1---11111--1 -------------1----------------------------------------------------------------------------------------------1------------------------------------------------------------------111--11-111121---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 98.7 SQ:SECSTR cEEEEEEEcccccHHHHHHHHHHHTTccTTccEEEEEEccccccTTccHHHHHHHHHHHHHHHccTTcEEEEEEEEEEcccHHHHHHHHHHHHTTcccEEEEEccTTcccHHHHHHccEEEccccccccHHHHHHHHHHHHHHHHHHHTTccccc## DISOP:02AL 41-56, 152-157| PSIPRED cEEEEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccc //