[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59121.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.2
:97 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  7->97 1ywuA1  b.45.2.1 * 2e-10 14.1 %
:HMM:SCOP  7->97 1ywuA1 b.45.2.1 * 6.6e-08 26.8 %
:HMM:PFM   9->96 PF07238 * PilZ 6.1e-15 28.0 82/102  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59121.1 GT:GENE ABA59121.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3023916..3024209) GB:FROM 3023916 GB:TO 3024209 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59121.1 GB:DB_XREF GI:76884440 LENGTH 97 SQ:AASEQ MPSGDFMVEKRKSERLPVTVEVRVKRKSSPEEPLIFKTHDLSNNGIFLGADGQELPPVGEKVTVQLKNSLANGETPPLLTAEIVRQDSRGVGLRFLD GT:EXON 1|1-97:0| HM:PFM:NREP 1 HM:PFM:REP 9->96|PF07238|6.1e-15|28.0|82/102|PilZ| RP:SCP:NREP 1 RP:SCP:REP 7->97|1ywuA1|2e-10|14.1|85/125|b.45.2.1| HM:SCP:REP 7->97|1ywuA1|6.6e-08|26.8|82/0|b.45.2.1|1/1|PilZ domain-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1----------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccEEEEcEEcccccEEEEEEEEcccccccEEEEEEEEcccccEEEEEccEEEcccccEEEEEEEEEccccccccEEEEEEEEEccccEEEEEEc //